spacer

EBI Dbfetch

ID   Y13785; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   Y13785;
XX
DT   12-DEC-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene, exon 2
XX
KW   exon 2; HLA-DRB1 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RA   Hashemi-tavoularis S.;
RT   ;
RL   Submitted (12-JUN-1997) to the INSDC.
RL   Hashemi-tavoularis S., HLA section, Canadian red Cross, 1800 Alta Vista
RL   drive K1G 4J5 CANADA.
XX
RN   [2]
RP   1-246
RA   Buyse I.M., Couture C., Ouellet S., Hashemi-tavoularis S.;
RT   "Identification of novel DR7, DRB5 and DQB1*03 alleles using the CANTYPE
RT   assay.";
RL   Unpublished.
XX
DR   MD5; 7ac7fb94439cbf6824171a269d8034f1.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_line="DR7RMT, ED1436"
FT                   /cell_type="B-cell"
FT                   /tissue_type="Blood"
FT                   /note="allele: DRB1*07, DRB4*0101/0103"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /db_xref="GOA:P13761"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*07:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13761"
FT                   /protein_id="CAA74112.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLESLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVG"
FT   exon            1..246
FT                   /number=2
XX
SQ   Sequence 246 BP; 51 A; 57 C; 91 G; 47 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagtctcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtg                                                                  246
//


spacer
spacer