spacer

EBI Dbfetch

ID   Y12470; SV 1; linear; genomic DNA; STD; HUM; 241 BP.
XX
AC   Y12470;
XX
DT   08-SEP-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   H.sapiens HLA-A gene, exon 2
XX
KW   alpha1 gene; exon 2; HLA-A gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-241
RA   Tilanus M.G.J.;
RT   ;
RL   Submitted (09-APR-1997) to the INSDC.
RL   M.G.J. Tilanus, University Hopsital Utrecht, Section Molecular Pathology,
RL   Room HO4.312 Heidelberglaan 100, 3584 CX Utrecht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1016/S0198-8859(97)00204-8.
RX   PUBMED; 9438203.
RA   Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B.,
RA   der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G.,
RA   Kronink M.N., Tilanus M.G.J.;
RT   "A generic sequencing based typing approach for the identification of HLA-A
RT   diversity";
RL   Hum. Immunol. 57(2):120-128(1997).
XX
DR   MD5; 47a94a83b4188f76bac8cf0604b50f70.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000265434; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000583265; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..241
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="04VC"
FT                   /isolate="UCLA 144"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>241
FT                   /codon_start=3
FT                   /product="HLA-A alpha1 exon2"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="CAA73073.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTL"
FT   exon            <1..>241
FT                   /number=2
XX
SQ   Sequence 241 BP; 48 A; 75 C; 83 G; 35 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     t                                                                       241
//


spacer
spacer