Dbfetch

ID   Y12469; SV 1; linear; genomic DNA; STD; HUM; 380 BP.
XX
AC   Y12469;
XX
DT   08-SEP-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   H.sapiens HLA-A gene, exon 3
XX
KW   alpha2 gene; exon 3; HLA-A gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-380
RA   Tilanus M.G.J.;
RT   ;
RL   Submitted (09-APR-1997) to the INSDC.
RL   M.G.J. Tilanus, University Hopsital Utrecht, Section Molecular Pathology,
RL   Room HO4.312 Heidelberglaan 100, 3584 CX Utrecht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1016/S0198-8859(97)00204-8.
RX   PUBMED; 9438203.
RA   Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B.,
RA   der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G.,
RA   Kronink M.N., Tilanus M.G.J.;
RT   "A generic sequencing based typing approach for the identification of HLA-A
RT   diversity";
RL   Hum. Immunol. 57(2):120-128(1997).
XX
DR   MD5; 40159f521e7c2dc530d7ad1569e5bc09.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..380
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="04VC"
FT                   /isolate="UCLA 144"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..104
FT                   /number=3
FT   CDS             105..>380
FT                   /codon_start=3
FT                   /product="HLA-A alpha2 exon3"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="PDB:5BRZ"
FT                   /db_xref="PDB:5BS0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="CAA73072.1"
FT                   /translation="SHTIQMMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
FT                   DMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRT"
FT   exon            105..>380
FT                   /number=3
XX
SQ   Sequence 380 BP; 67 A; 108 C; 145 G; 60 T; 0 other;
     cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt ggttggggcg        60
     gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccatcca       120
     gatgatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt accggcagga       180
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt ggaccgcggc       240
     ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg cggagcagcg       300
     gagagtctac ctggagggcc ggtgcgtgga cgggctccgc agatacctgg agaacgggaa       360
     ggagacgctg cagcgcacgg                                                   380
//