Dbfetch

ID   Y10695; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   Y10695;
XX
DT   23-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   H.sapiens HLA-A*2410 gene, exon 2 & 3
XX
KW   HLA-A allele; HLA-A*2410.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Williams F., Middleton D., Curran M.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Williams F.;
RT   ;
RL   Submitted (21-JAN-1997) to the INSDC.
RL   F. Williams, Northern Ireland Regional Tissue Typing, Service, Blood
RL   Tranfusion Building, City Hospital, Belfast, BT9 7TS, IRELAND
XX
DR   MD5; dcbd311193afddd81e158f186e7cd10b.
XX
CC   Overlaps with U37110 and U37111
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="pf16"
FT                   /clone="pf1"
FT                   /clone="pf11"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=1
FT                   /gene="HLA-A*2410"
FT                   /product="heavy chain of HLA-A antigen"
FT                   /db_xref="IMGT/HLA:A*24:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P79484"
FT                   /protein_id="CAA71701.1"
FT                   /translation="GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
FT                   EPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVG
FT                   SDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGR
FT                   CVEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A*2410"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-A*2410"
FT                   /number=3
FT   variation       487..488
FT                   /replace="ac"
FT                   /note="HLA-A*2403"
XX
SQ   Sequence 546 BP; 110 A; 164 C; 195 G; 77 T; 0 other;
     ggctcccact ccatgaggta tttctccaca tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       120
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gacgaggaga cagggaaagt gaaggcccac tcacagactg accgagagaa cctgcggatc       240
     gcgctccgct actacaacca gagcgaggcc ggttctcaca ccctccagat gatgtttggc       300
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       360
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       420
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       480
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       540
     cgcacg                                                                  546
//