spacer

EBI Dbfetch

ID   Y09058; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   Y09058;
XX
DT   20-NOV-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   H.sapiens mRNA for HLA-B antigen alpha chain (B*39GB)
XX
KW   alpha/beta-2 microglobulin; HLA-B alpha chain; HLA-B*39GB.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-1089
RA   Vilches C.;
RT   ;
RL   Submitted (25-OCT-1996) to the INSDC.
RL   C. Vilches, Servicio de Inmunologia, Hospital Puerta de Hierro, San Martin
RL   de Porres 4, E- 28035 Madrid, SPAIN
XX
RN   [3]
RP   1-1089
RX   DOI; 10.1111/j.1399-0039.1997.tb02814.x.
RX   PUBMED; 9234488.
RA   Vilches C., Bunce M., de Pablo R., Moreno M.E., Puente S., Sanz L.,
RA   Kreisler M.;
RT   "The novel HLA-Cw*1802 allele is associated with B*5703 in the Bubi
RT   population from Equatorial Guinea";
RL   Tissue Antigens 49(6):644-648(1997).
XX
DR   MD5; 3169ac63ea6d91fd536dda70ecd4dc42.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /isolate="GB32"
FT                   /mol_type="mRNA"
FT                   /clone="15,27"
FT                   /cell_line="GB32"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /gene="HLA-B*39GB"
FT                   /product="HLA-B alpha chain (B*39GB)"
FT                   /note="alpha /beta-2 microglobulin"
FT                   /db_xref="GOA:P30475"
FT                   /db_xref="H-InvDB:HIT000325496.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*39:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:4O2C"
FT                   /db_xref="PDB:4O2E"
FT                   /db_xref="PDB:4O2F"
FT                   /protein_id="CAA70261.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     1..72
FT   mat_peptide     73..1086
XX
SQ   Sequence 1089 BP; 222 A; 336 C; 358 G; 173 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaagacca acacacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agaacctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagacagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagttc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer