spacer

EBI Dbfetch

ID   Y07824; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   Y07824;
XX
DT   11-SEP-1996 (Rel. 49, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens HLA-B gene, exon 2 and 3
XX
KW   HLA-B gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Blasczyk R.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dep. Of Internal Medicine, Division Of Hematology
RL   And Oncology, Virchow-Klinikum, Humboldt-University, Augustenburger Platz
RL   1, 13353 Berlin, FRG
XX
DR   MD5; eb33a23f2669d8326a8d03c4b63e5ce2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="A1,2"
FT                   /isolate="B8,18"
FT                   /isolate="Cw7,7"
FT                   /isolate="DR3,11"
FT                   /isolate="DQ2,3"
FT                   /mol_type="mRNA"
FT                   /cell_line="GSW002"
FT                   /cell_type="LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /note="allele B*1803"
FT                   /db_xref="GOA:Q95363"
FT                   /db_xref="H-InvDB:HIT000325363.9"
FT                   /db_xref="IMGT/HLA:B*18:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95363"
FT                   /protein_id="CAA69157.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="allele B*1803"
FT   exon            271..>546
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="allele B*1803"
FT                   /note="received with codon_start=3"
XX
SQ   Sequence 546 BP; 110 A; 178 C; 190 G; 68 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer