Dbfetch

ID   X99841; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   X99841;
XX
DT   07-FEB-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   H.sapiens HLA-DRB1*11 gene, isolate CL01211
XX
KW   HLA-DRB1 gene; human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Buyse I., Couture C., Hashemi S.;
RT   "Identification of a novel DRB1*08 and two new DRB1*11 alleles using the
RT   CANTYPE Assay";
RL   Unpublished.
XX
RN   [2]
RP   1-246
RA   Hashemi S.;
RT   ;
RL   Submitted (07-AUG-1996) to the INSDC.
RL   S. Hashemi, The Canadian Red Cross Society, HLA Section, 1800 Alta Vista
RL   Drive, Ottawa, ON K1G 4J5, CANADA
XX
DR   MD5; d14d8587515cdac200f8453e3dce140d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /isolate="CL01211"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /product="human leukocyte antigen"
FT                   /note="DRB1*11 allele"
FT                   /db_xref="GOA:Q99948"
FT                   /db_xref="IMGT/HLA:DRB1*11:29:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q99948"
FT                   /protein_id="CAA68152.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVG"
XX
SQ   Sequence 246 BP; 51 A; 57 C; 88 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtg                                                                  246
//