spacer

EBI Dbfetch

ID   X98742; SV 1; linear; mRNA; STD; HUM; 1119 BP.
XX
AC   X98742;
XX
DT   18-OCT-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   H.sapiens mRNA for HLA-C alpha chain (Cw*17)
XX
KW   HLA-Cw*17 gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1997.tb02749.x.
RX   PUBMED; 9098935.
RA   Herrero M.J., Vilches C., de Pablo R., Puente S., Kreisler M.;
RT   "The complete primary structure of Cw*1701 reveals a highly divergent HLA
RT   class I molecule";
RL   Tissue Antigens 49(3 Pt 1):267-270(1997).
XX
RN   [2]
RP   1-1119
RA   Herrero M.J.;
RT   ;
RL   Submitted (24-JUN-1996) to the INSDC.
RL   M.J. Herrero, Servicio de Inmunologia, Hospital Puerta de Hierro, San
RL   Martin de Porres 4, 28035 Madrid, SPAIN
XX
DR   MD5; 7e5bb03781068f2a549c26388fb47adb.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1119
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="mRNA"
FT                   /clone="A6"
FT                   /clone="A25"
FT                   /clone="B13"
FT                   /clone="B19"
FT                   /cell_line="GB86"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1119
FT                   /gene="HLA-Cw*17"
FT                   /product="human leukocyte antigen-C alpha chain"
FT                   /db_xref="GOA:Q95604"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*17:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95604"
FT                   /protein_id="CAA67294.1"
FT                   /translation="MRVMAPQALLLLLSGALALIETWAGSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAVLAVLAVLAVLGAVVAAVIHR
FT                   RKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   sig_peptide     1..72
FT   mat_peptide     73..1116
XX
SQ   Sequence 1119 BP; 219 A; 343 C; 377 G; 180 T; 0 other;
     atgcgggtca tggcgcccca agccctcctc ctgctgctct cgggagccct ggccctgatc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgcggcg       480
     gacacggcgg ctcagatctc ccagcgcaag ttggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgcg gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acgcccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agaacagaga       840
     tacacgtgcc atgtgcagca cgaggggctg caggagccct gcaccctgag atggaagccg       900
     tcttcccagc ccaccatccc caacttgggc atcgtttctg gcccagctgt cctggctgtc       960
     ctggctgtcc tggctgtcct agctgtccta ggagctgtgg tcgctgctgt gatacatagg      1020
     aggaagagct caggtggaaa aggagggagc tgctctcagg ctgcgtccag caacagtgcc      1080
     cagggctctg atgagtctct catcgcttgt aaagcctga                             1119
//


spacer
spacer