spacer

EBI Dbfetch

ID   X97433; SV 1; linear; genomic DNA; STD; PLN; 3202 BP.
XX
AC   X97433;
XX
DT   29-APR-1997 (Rel. 51, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   E.gunnii CCR1 gene
XX
KW   CCR1 gene; cinnamoyl CoA reductase.
XX
OS   Eucalyptus gunnii (cider tree)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Myrtales; Myrtaceae; Eucalyptus.
XX
RN   [2]
RP   1-3202
RA   Grima-Pettenati J.;
RT   ;
RL   Submitted (22-APR-1996) to the INSDC.
RL   J. Grima-Pettenati, Universite Paul Sabatier, Centre de Physiologie
RL   Vegetale, UMR CNRS 5546, 118 Route de Narbonne, 31062 Toulouse Cedex,
RL   FRANCE
XX
RN   [3]
RX   DOI; 10.1046/j.1365-313X.1997.11030429.x.
RX   PUBMED; 9107033.
RA   Lacombe E., Hawkins S., Van Doorsselaere J., Piquemal J., Goffner D.,
RA   Poeydomenge O., Boudet A.M., Grima-Pettenati J.;
RT   "Cinnamoyl CoA reductase, the first committed enzyme of the lignin branch
RT   biosynthetic pathway: cloning, expression and phylogenetic relationships";
RL   Plant J. 11(3):429-441(1997).
XX
RN   [4]
RA   Pichon M., Courbou I., Beckert M., Boudet A.M., Grima-Pettenati J.;
RT   "Cloning and expression of two cDNAs encoding cinnamoyl CoA reductase from
RT   maize";
RL   Plant Mol. Biol. 0:0-0(0).
XX
DR   MD5; b0ef57fcb07ed5621323f3adb6b309ea.
DR   EuropePMC; PMC3060884; 21375742.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3202
FT                   /organism="Eucalyptus gunnii"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="EMBL3 SP6 /T7"
FT                   /clone="0867"
FT                   /sub_clone="pBS SK M13+"
FT                   /cell_line="Eucalyptus gunnii (Association Cellulose
FT                   Foret)"
FT                   /db_xref="taxon:3933"
FT   mRNA            join(1..324,434..589,1253..1437,1604..1958,2983..3201)
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1..324
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             join(192..324,434..589,1253..1437,1604..1958,2983..3107)
FT                   /gene="CCR1"
FT                   /product="cinnamoyl-CoA reductase"
FT                   /EC_number="1.2.1.44"
FT                   /db_xref="GOA:O04878"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:O04878"
FT                   /protein_id="CAA66063.1"
FT                   /translation="MPVDALPGSGQTVCVTGAGGFIASWIVKLLLERGYTVRGTVRNPD
FT                   DPKNGHLRELEGASERLTLYKGDLMDYGSLEEAIKGCDGVVHTASPVTDDPEQMVEPAV
FT                   IGTKNVIVAAAEAKVRRVVFTSSIGAVTMDPNRGPDVVVDESCWSDLEFCKSTKNWYCY
FT                   GKAVAEKAAWPEAKERGVDLVVINPVLVLGPLLQSTINASIIHILKYLTGSAKTYANSV
FT                   QAYVHVKDVALAHVLVLETPSASGRYLCAESVLHRGDVVEILAKFFPEYNVPTKSKLSR
FT                   ACRRKATYPSPPPRKIRCVFRDDLRSITVHICNPEK"
FT   intron          325..433
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            434..589
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          590..1252
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1253..1437
FT                   /number=3
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          1438..1603
FT                   /number=3
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1604..1958
FT                   /number=4
FT   intron          1959..2982
FT                   /number=4
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2983..3201
FT                   /number=5
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 3202 BP; 803 A; 827 C; 751 G; 821 T; 0 other;
     accttcgaat caagccgtca aaaagcgtcc aaaagtcctg ccttccctgt gcatgcccga        60
     aaaagcggcc cccctcctct cctcctcctc ctcctcctcc tccctcccct ctccaaccac       120
     cgcccctcaa acgtcagcac ctccctcctc cacctcctga acccctctcc cccctcgccg       180
     gcaatcccac catgcccgtc gacgccctcc ccggttccgg ccagaccgtt tgcgtcaccg       240
     gcgccggcgg cttcatcgcc tcctggattg tcaagcttct cctcgagcga ggctacaccg       300
     tgcgaggaac cgtcaggaac ccaggtatgg atagataaaa aaaaccaaaa agaaacgcga       360
     attcgatgcg gtggatatgt ttgcgacttt cttttccttc cggagataat ccatgttgat       420
     tatgtgcgtg tagacgaccc gaagaatggg catctgagag agctggaagg agccagcgag       480
     aggctgacgc tgtacaaggg tgatctgatg gactacggga gcttggaaga agccatcaag       540
     gggtgcgacg gcgtcgtcca caccgcctct ccggtcaccg acgatcctgt gagtccccca       600
     attatccaat catcccttcc ccgtcctcgt cctctcttag ctagtcctgt ttccgttatt       660
     cgccatgagt gtgtcggcag agttggagtg aggtgtgctt aagctccacg cacggctata       720
     ccctcggtct tttccaaggg acagatggcc gagacatggt ccctgtaatc ccttccagtt       780
     tacagggacc aagttttggg attaatcaca agaatgtgcg atggcgaacc gatgaattcg       840
     cataaaaatg gatcttgttt ggcaattgca tctagcgagt acacatgcct cgagagattt       900
     tcagacgatt ggggaggaaa taggaaatag ataaagtaaa ggattgatcg cctgtcctct       960
     ttcttctgca ttttttctcc tccaccaacc caaaccatat ggaccccgga ccaaacctta      1020
     aaaaatgaca tcaaaatctt aattcgtgcc ggcgcgcgat tggcttttct cgaaaggtgg      1080
     tccccacgta agaaagaggg accggcatcc ttctcgccct tcaatcatat ccgcacatta      1140
     gtgacatttc attaattcta cattaaatgt tatgggcggc cgtactgatg tcttttgctg      1200
     catttaaaac gttccggtga tctcaaatta ttgacttgtt cgaatgcgca ggagcaaatg      1260
     gtggagccag cggtgatcgg gacgaaaaat gtgatcgtcg cagcggcgga ggccaaggtc      1320
     cggcgggttg tgttcacctc ctccatcggt gcagtcacca tggaccccaa ccggggtccg      1380
     gacgttgtgg tggacgagtc ttgttggagc gacctcgaat tttgcaagag cactaaggtc      1440
     atatttgatt attctcctta attctcgcat ccatttctgg gctgaccaag tcaacgcgtc      1500
     acttgagcca ttgttgacca aagacctagt cacatatcga gcatttttac ccaaatgtgt      1560
     taaatcccca tgtttaaaat agatcccgta tttggtcccg cagaactggt attgctacgg      1620
     caaggcagtg gcggagaagg ccgcttggcc agaggcgaag gagagagggg ttgacctcgt      1680
     ggtgattaac cctgtgctcg tgcttggacc gctccttcag tcgacgatca atgctagcat      1740
     catccacatc ctcaagtact tgactggctc agccaagacc tacgccaact cggtccaggc      1800
     gtacgtgcac gtcaaggacg tcgcgcttgc ccacgtcctt gtcttggaga ccccatccgc      1860
     ctcaggccgc tatttgtgcg ccgagagcgt cctccaccgt ggcgatgtgg tggaaatcct      1920
     tgccaagttc ttccctgagt ataacgtacc gaccaagtaa gtattctttg atggacagtc      1980
     caacttatat tacgcgcttt ccgttataca cccgaaaaaa acattttaat aaggagattg      2040
     caaaaactta gatagatagt cccgcaattg attgtcgtag gtgcacatga tagttaatac      2100
     caaaataact tcaatgttta aaacagctta aacgataagt taatagaatt actcaagctg      2160
     atgtggtcca agcgtcgatt ttgcatattt ttggacatac tataaatgga agactggacc      2220
     aactgcaggt gtgggttgtc ggttcactct tgtaagttcc aattgccaat tggtgtcagt      2280
     ctctctctct ctctagaagc cacagatatc tagttggtga gggcaaaagg gaggaaattg      2340
     agaaaattct gcagagggct tcatgacgca atcctatcat cattattaaa acttaaaaga      2400
     tgaacaaaga gacggaaaac aatagttgta aaaattgaga attaaggaaa aggaggagaa      2460
     tcaggtggac ggacacatta ctgtcctaag gacaccgtca tcatcgttct ctcttgaggt      2520
     cgtggcacag ttggtgtacc gacccttttg actttcggtg gaaaagatgt aggacgaaat      2580
     attgaggcac aatcttaaat ctactgtgtg gaggaggagt atcctcacct accctcccca      2640
     acccaatcca tgtccgcgtt ctctaaattg gacctccctg tcttgaatcc ctttgatcaa      2700
     tcattctctc tcttcttttc ctatcctcat gagacatatc acatgttggt ggacaacttt      2760
     tcattgatct cgaacgaatg gagtcgcttt aatccatgtt tgtttgttga atccatgtga      2820
     tgtgtcgaga ttacgactgg gtccgttctc agctgaggtt gcaatggccc ctctgtgcag      2880
     gtgctctgat gaggtgaacc caagagtaaa gccatacaag ttctccaacc agaagctgag      2940
     agacttgggg ctcgagttca ccccggtgaa gcagtgcctg tacgaaactg tcaagagctt      3000
     gcaggagaaa ggccacctac ccgtcccctc ccccccggaa gattcggtgc gtattcaggg      3060
     atgatcttag atccatcacg gtgcacattt gtaatccgga gaaatgagag aaacatgtgg      3120
     gaatttgttt gtacttttct aagtcaaacc tggagatacc aaccctgagt tctgcattgg      3180
     aatggaagtt gtcaattgtt ca                                               3202
//


spacer
spacer