spacer

EBI Dbfetch

ID   X97321; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   X97321;
XX
DT   30-JUL-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   H.sapiens mRNA for human leukocyte antigen C alpha chain
XX
KW   HLA-C alpha chain; HLA-Cw*07.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1996.tb02694.x.
RX   PUBMED; 9008313.
RA   Vilches C., Bunce M., Sanz L., de Pablo R., Puente S., Kreisler M.;
RT   "Molecular cloning of two new HLA-C alleles: Cw*1801 and Cw*0706";
RL   Tissue Antigens 48(6):698-702(1996).
XX
RN   [2]
RP   1-1101
RA   Vilches C.;
RT   ;
RL   Submitted (18-APR-1996) to the INSDC.
RL   C. Vilches, Servicio de Inmunologia, Hospital Puerta de Hierro, San Martin
RL   de Porres 4, E- 28035 Madrid, SPAIN
XX
DR   MD5; 3260c9b8504ed0b81b272d723fb7dc5c.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="21.3"
FT                   /isolate="GB92"
FT                   /mol_type="mRNA"
FT                   /clone="15"
FT                   /clone="38"
FT                   /clone="39"
FT                   /clone="41"
FT                   /cell_line="GB92"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT   CDS             1..1101
FT                   /gene="HLA-Cw*07GB"
FT                   /product="HLA-C protein"
FT                   /note="alpha chain"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="H-InvDB:HIT000324991.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="CAA65986.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAKMCRRKSSGG
FT                   KGGSCSQVACSNSAQGSDESLITCKA"
FT   mat_peptide     73..1098
XX
SQ   Sequence 1101 BP; 216 A; 346 C; 368 G; 171 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacaggc tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg cccgtgcggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcaga acccccaaag acacacgtga cccaccaccc cctctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agagcagaga       840
     tacacgtgcc atatgcagca cgaggggctg caagagcccc tcaccctgag ctgggagcca       900
     tcttcccagc ccaccatccc catcatgggc atcgttgctg gcctggctgt cctggttgtc       960
     ctagctgtcc ttggagctgt ggtcaccgct aagatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggttgcgtgc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcactt gtaaagcctg a                                                1101
//


spacer
spacer