spacer

EBI Dbfetch

ID   X96724; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   X96724;
XX
DT   27-MAR-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 30)
XX
DE   Homo sapiens mRNA for human leukocyte antigen HLA-A-02
XX
KW   cell surface protein; HLA-A*02 gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1996.tb02691.x.
RX   PUBMED; 9008310.
RA   Fleischhauer K., Zino E., Mazzi B., Severini G.M., Benazzi E.,
RA   Bordignon C.;
RT   "HLA-A*02 subtype distribution in Caucasians from northern Italy:
RT   identification of A*0220";
RL   Tissue Antigens 48(6):673-679(1996).
XX
RN   [2]
RC   revised by [3]
RA   Fleischhauer K.L.;
RT   ;
RL   Submitted (21-MAR-1996) to the INSDC.
RL   K.L. Fleischhauer, Centro Scientifico H.S. Raffaele, Tissue Typing
RL   Laboratory, DIBIT 4A1, Via Olgettina 58, 20132 Milano, ITALY
XX
RN   [3]
RC   revised by [4]
RA   Fleischhauer K.L.;
RT   ;
RL   Submitted (30-APR-1996) to the INSDC.
RL   K.L. Fleischhauer, Centro Scientifico H.S. Raffaele, Tissue Typing
RL   Laboratory, DIBIT 4A1, Via Olgettina 58, 20132 Milano, ITALY
XX
RN   [4]
RP   1-1098
RA   Fleischhauer K.L.;
RT   ;
RL   Submitted (08-JUL-1997) to the INSDC.
RL   K.L. Fleischhauer, Centro Scientifico H.S. Raffaele, Tissue Typing
RL   Laboratory, DIBIT 4A1, Via Olgettina 58, 20132 Milano, ITALY
XX
DR   MD5; a087ac3d974c5cf96918871d0b06d636.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
CC   Related sequence K02883
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="patient BI"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /gene="HLA-A-02"
FT                   /product="human leukocyte antigen"
FT                   /note="variant HLA-A-0220"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="H-InvDB:HIT000324957.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*02:20:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4EUQ"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="PDB:4NNX"
FT                   /db_xref="PDB:4NNY"
FT                   /db_xref="PDB:4NO0"
FT                   /db_xref="PDB:4NO2"
FT                   /db_xref="PDB:4NO3"
FT                   /db_xref="PDB:4NO5"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="PDB:4QOK"
FT                   /db_xref="PDB:4U6X"
FT                   /db_xref="PDB:4U6Y"
FT                   /db_xref="PDB:4UQ3"
FT                   /db_xref="PDB:4WJ5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /protein_id="CAA65501.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRNVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            1..72
FT                   /number=1
FT   exon            73..342
FT                   /number=2
FT   exon            343..618
FT                   /number=3
FT   exon            619..894
FT                   /number=4
FT   exon            895..1011
FT                   /number=5
FT   exon            1012..1044
FT                   /number=6
FT   exon            1045..1089
FT                   /number=7
FT   exon            1090..1098
FT                   /number=8
XX
SQ   Sequence 1098 BP; 219 A; 323 C; 368 G; 188 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggctctca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt       240
     ccggagtatt gggacgggga gacacggaat gtgaaggccc actcacagac tcaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag       360
     aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc tccgcgggta ccaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac       660
     catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct       960
     gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer