Dbfetch

ID   X96638; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   X96638;
XX
DT   01-SEP-1996 (Rel. 49, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens HLA-A gene, A66Ka exon2 2 and 3
XX
KW   alpha 1 domain; HLA-A*66 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1997.tb02840.x.
RX   PUBMED; 9243762.
RA   Binder T., Wehling J., Huhn D., Blasczyk R.;
RT   "Increased diversity within the HLA-A*66 group: implications for matching
RT   in unrelated bone marrow transplantation";
RL   Tissue Antigens 50(1):77-82(1997).
XX
RN   [2]
RP   1-546
RA   Blasczyk R.;
RT   ;
RL   Submitted (15-MAR-1996) to the INSDC.
RL   R. Blasczyk, Blutbank, Department of Internal Medicine, Division of
RL   Hematology and Oncology, Virchow-Klinikum, Humboldt-University,
RL   Augustenburger Platz 1, 13353 Berlin, FRG
XX
DR   MD5; abd12498c49144efaaf2ae6edffff78c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p12.3"
FT                   /isolate="patient 951477"
FT                   /mol_type="mRNA"
FT                   /cell_type="peripheral lymphocytes"
FT                   /tissue_type="A*3201,B39,Cw7/A66KA,B45,Cw-"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="alpha1 domain"
FT                   /note="allele A*66"
FT                   /db_xref="H-InvDB:HIT000324951.9"
FT                   /db_xref="IMGT/HLA:A*66:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q95361"
FT                   /protein_id="CAA65442.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="allele A*66"
FT   exon            271..546
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="allele A*66"
XX
SQ   Sequence 546 BP; 109 A; 164 C; 198 G; 75 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac catccagagg atgtatggct       300
     gcgacgtggg gccggacggg cgcttcctcc gcgggtacca gcaggacgct tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gagacggccc atgaggcgga gcagtggaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//