Dbfetch

ID   X95656; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   X95656;
XX
DT   22-FEB-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens HLA DRB1 gene
XX
KW   HLA-DRB1 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Enczmann J.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-246
RA   Enczmann J.;
RT   ;
RL   Submitted (13-FEB-1996) to the INSDC.
RL   J. Enczmann, University of Duesseldorf, KMS-Registry, Moorenstr. 5, Bldg.
RL   14.80, 40225 Duesseldorf, FRG
XX
DR   MD5; b41a527acc4ce5ab15558dc55b1fff2b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="2166/1018"
FT                   /mol_type="genomic DNA"
FT                   /note="Caucasian"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=2
FT                   /gene="HLA DRB1 gene"
FT                   /note="DR11"
FT                   /db_xref="GOA:Q29894"
FT                   /db_xref="IMGT/HLA:DRB1*11:27:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29894"
FT                   /protein_id="CAA64958.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVT
FT                   ELGRPDEEYWNSQKDFLEDRRAAVDNYCRHNYGVGE"
XX
SQ   Sequence 246 BP; 54 A; 52 C; 89 G; 51 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgaggag tactggaaca gccagaagga       180
     cttcctggaa gacaggcggg ccgcggtgga caattactgc agacacaact acggggttgg       240
     tgagag                                                                  246
//