Dbfetch

ID   X94481; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   X94481;
XX
DT   11-JAN-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens HLA-B gene, HLA-B*5101 variant (exons 2 & 3)
XX
KW   HLA-B*5101; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-546
RA   Curran M.D.;
RT   ;
RL   Submitted (28-DEC-1995) to the INSDC.
RL   M.D. Curran, Belfast City Hospital, Tissue Typing Lab, Belfast, BT9 7AD,
RL   Nothern Ireland, UK
XX
RN   [3]
RP   1-546
RX   DOI; 10.1111/j.1399-0039.1996.tb02636.x.
RX   PUBMED; 8896186.
RA   Curran M.D., Williams F., Rima B.K., Markwick J., Middleton D.;
RT   "A new HLA-B51 allele, B*5107 in RCE55 detected and characterized by
RT   PCR-SSOP, cloning and nucleotide sequence determination";
RL   Tissue Antigens 48(3):228-230(1996).
XX
DR   MD5; 878c205ee7d06050baf0b6fc0e5f6506.
XX
CC   Overlaps with L33923.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="short arm"
FT                   /mol_type="genomic DNA"
FT                   /clone="pM203"
FT                   /clone="pM212"
FT                   /clone="pM213"
FT                   /cell_line="RCE55"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B*5101 variant"
FT                   /product="MHC type I antigen"
FT                   /note="alpha 1 and alpha 2 domains"
FT                   /db_xref="IMGT/HLA:B*51:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q29765"
FT                   /protein_id="CAA64228.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            <1..270
FT                   /number=2
FT   variation       199
FT                   /replace="a"
FT                   /note="single substitution in HLA-B*5101"
FT   exon            271..>546
FT                   /number=3
XX
SQ   Sequence 546 BP; 115 A; 173 C; 186 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//