spacer

EBI Dbfetch

ID   X94480; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   X94480;
XX
DT   11-JAN-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens HLA-B gene, HLA-B18 variant (exons 2 & 3)
XX
KW   HLA-B*18; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-546
RA   Curran M.D.;
RT   ;
RL   Submitted (28-DEC-1995) to the INSDC.
RL   M.D. Curran, Belfast City Hospital, Tissue Typing Lab, Belfast, BT9 7AD,
RL   Nothern Ireland, UK
XX
RN   [3]
RP   1-546
RA   Curran M.D., Williams F., Middleton D.;
RT   "Identification of a new HLA-B*55, HLA-B*5503";
RL   Tissue Antigens 47:708-710(1996).
XX
DR   MD5; eb33a23f2669d8326a8d03c4b63e5ce2.
XX
CC   Overlaps with L33923.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="short arm"
FT                   /isolate="BM66(BL)"
FT                   /mol_type="genomic DNA"
FT                   /clone="pM3"
FT                   /clone="pM6"
FT                   /clone="pM7"
FT                   /cell_line="BEL 8 BL"
FT                   /note="bone marrow donor registry"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B*18 variant"
FT                   /product="MHC type I antigen"
FT                   /note="alpha 1 and alpha 2 domains"
FT                   /db_xref="GOA:Q29759"
FT                   /db_xref="IMGT/HLA:B*18:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29759"
FT                   /protein_id="CAA64227.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            <1..270
FT                   /number=2
FT   variation       217
FT                   /replace="t"
FT                   /note="single substitution in HLA-B*1801"
FT   exon            271..>546
FT                   /number=3
XX
SQ   Sequence 546 BP; 110 A; 178 C; 190 G; 68 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer