Dbfetch

ID   X91625; SV 1; linear; mRNA; STD; HUM; 2380 BP.
XX
AC   X91625;
XX
DT   03-MAY-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   H.sapiens mRNA for MHC class I mic-B antigen
XX
KW   MHC class I antigen; mic-B gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1007/s002510050051.
RX   PUBMED; 8575823.
RA   Bahram S., Spies T.;
RT   "Nucleotide sequence of a human MHC class I MICB cDNA";
RL   Immunogenetics 43(4):230-233(1996).
XX
RN   [2]
RP   1-2380
RA   Bahram S.;
RT   ;
RL   Submitted (18-SEP-1995) to the INSDC.
RL   S. Bahram, Faculte de Medecine, Centre de Recherche d'Immunologie, 4 rue
RL   Kirschleger, STRASBOURG, 67085 Strasbourg Cedex, FRANCE
XX
DR   MD5; 36ad9b71755408fc05045abe18d72110.
DR   IMGT/LIGM; X91625.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2380
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="Hela, IMR90"
FT                   /db_xref="taxon:9606"
FT   CDS             6..1157
FT                   /gene="micB"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="H-InvDB:HIT000324461_03.4"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*001"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAA62823.1"
FT                   /translation="MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDESVQSGF
FT                   LAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIK
FT                   DQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAM
FT                   NVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNIT
FT                   VTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFT
FT                   CYMEHSGNHGTHPVPSGKVLVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEG
FT                   PELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA"
XX
SQ   Sequence 2380 BP; 570 A; 617 C; 568 G; 625 T; 0 other;
     gggccatggg gctgggccgg gtcctgctgt ttctggccgt cgccttccct tttgcacccc        60
     cggcagccgc cgctgagccc cacagtcttc gttacaacct catggtgctg tcccaggatg       120
     aatctgtgca gtcagggttt ctcgctgagg gacatctgga tggtcagccc ttcctgcgct       180
     atgacaggca gaaacgcagg gcaaagcccc agggacagtg ggcagaagat gtcctgggag       240
     ctaagacctg ggacacagag accgaggact tgacagagaa tgggcaagac ctcaggagga       300
     ccctgactca tatcaaggac cagaaaggag gcttgcattc cctccaggag attagggtct       360
     gtgagatcca tgaagacagc agcaccaggg gctcccggca tttctactac gatggggagc       420
     tcttcctctc ccaaaacctg gagactcaag aatcgacagt gccccagtcc tccagagctc       480
     agaccttggc tatgaacgtc acaaatttct ggaaggaaga tgccatgaag accaagacac       540
     actatcgcgc tatgcaggca gactgcctgc agaaactaca gcgatatctg aaatccgggg       600
     tggccatcag gagaacagtg ccccccatgg tgaatgtcac ctgcagcgag gtctcagagg       660
     gcaacatcac cgtgacatgc agggcttcca gcttctatcc ccggaatatc acactgacct       720
     ggcgtcagga tggggtatct ttgagccaca acacccagca gtggggggat gtcctgcctg       780
     atgggaatgg aacctaccag acctgggtgg ccaccaggat tcgccaagga gaggagcaga       840
     ggttcacctg ctacatggaa cacagcggga atcacggcac tcaccctgtg ccctctggga       900
     aggtgctggt gcttcagagt caacggacag actttccata tgtttctgct gctatgccat       960
     gttttgttat tattattatt ctctgtgtcc cttgttgcaa gaagaaaaca tcagcggcag      1020
     agggtccaga gcttgtgagc ctgcaggtcc tggatcaaca cccagttggg acaggagacc      1080
     acagggatgc agcacagctg ggatttcagc ctctgatgtc agctactggg tccactggtt      1140
     ccactgaggg cgcctagact ctacagccag gcggccagga ttcaactccc tgcctggatc      1200
     tcaccagcac tttccctctg tttcctgacc tatgaaacag aaaataacat cacttattta      1260
     ttgttgttgg atgctgcaaa gtgttagtag gtatgaggtg tttgctgctc tgccacgtag      1320
     agagccagca aagggatcat gaccaactca acattccatt ggaggctata tgatcaaaca      1380
     gcaaattgtt tatcatgaat gcaggatgtg ggcaaactca cgactgctcc tgccaacaga      1440
     aggtttgctg agggcattca ctccatggtg ctcattggag ttatctactg ggtcatctag      1500
     agcctattgt ttgaggaatg cagtcttaca agcctactct ggacccagca gctgactcct      1560
     tcttccaccc ctcttcttgc tatctcctat accaataaat acgaagggct gtggaagatc      1620
     agagcccttg ttcacgagaa gcaagaagcc ccctgacccc ttgttccaaa tatactcttt      1680
     tgtctttctc tttattccca cgttcgccct ttgttcagtc caatacaggg ttgtggggcc      1740
     cttaacagtg ccatattaat tggtatcatt atttctgttg tttttgtttt tgtttttgtt      1800
     tttgtttttg agacagagtc tcactcgtca cccaggctgc agttcactgg tgtgatctca      1860
     gctcactgca acctctgcct cccaggttca agcacttctc gtacctcaga ctcccgatag      1920
     ctgggattac agacaggcac caccacaccc agctaatttt tgtatttttt gtagagacgg      1980
     ggtttcgcca agttgaccag cccagtttca aactcctgac ctcaggtgat ctgcctgcct      2040
     tggcatccca aagtgctggg attacaagaa tgagccaccg tgcctggcct attttattat      2100
     attgtaatat attttattat attagccacc atgcctgtcc tattttctta tgttttaata      2160
     tattttaata tattacatgt gcagtaatta gattatcatg ggtgaacttt atgagtgagt      2220
     atcttggtga tgactcctcc tgaccagccc aggaccagct ttcttgtcac cttgaggtcc      2280
     cctcgccccg tcacaccgtt atcgattact ctgtgtctac tattatgtgt gcataattta      2340
     taccgtaaat gtttactctt taaataaaaa aaaaaaaaaa                            2380
//