spacer

EBI Dbfetch

ID   X91399; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   X91399;
XX
DT   09-OCT-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   H.sapiens mRNA for HLA-A11 antigen
XX
KW   HLA-A11 antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Tijssen H.J., Sistermans E.A., van den Beucken M.J.G., Krausa P.,
RA   Joosten I.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Tijssen H.;
RT   ;
RL   Submitted (12-SEP-1995) to the INSDC.
RL   H. Tijssen, Radboud University Hospital, Bloodtransf.s.
RL   Transplantat.Serology, P.O.Box 9101, 6500 HB Nijmegen, NETHERLANDS
XX
DR   MD5; b2464b1f4a1ea7f10444a5b9c2c2c5a9.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="MAD61"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /note="allele HLA-A11"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..>546)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC alpha chain"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4UQ2"
FT                   /protein_id="CAA62745.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAREAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /number=2
FT   exon            271..546
FT                   /number=3
XX
SQ   Sequence 546 BP; 110 A; 163 C; 199 G; 74 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gttctcacac catccagata atgtatggct       300
     gcgacgtggg gccggacggg cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcagctc       420
     agatcaccaa gcgcaagtgg gaggcggccc gtgaggcgga gcagcagaga gcctacctgg       480
     agggccggtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer