Dbfetch

ID   X87841; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   X87841;
XX
DT   04-JAN-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 16)
XX
DE   H.sapiens mRNA for HLA-C alpha chain (allele Cw*15052)
XX
KW   alpha chain; Cw*15052; HLA-C gene; major histocompatability complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1996.tb02561.x.
RX   PUBMED; 8773323.
RA   Sanz L., Vilches C., de Pablo R., Bunce M., Moreno M.E., Kreisler M.;
RT   "Haplotypic association of two new HLA class I alleles: Cw*15052 and
RT   B*0706: evolutionary relationships of HLA-Cw*15 alleles";
RL   Tissue Antigens 47(4):329-332(1996).
XX
RN   [2]
RP   1-1101
RA   Vilches C.;
RT   ;
RL   Submitted (08-JUN-1995) to the INSDC.
RL   C. Vilches, Servicio de Inmunologia, Hospital Puerta de Hierro, San Martin
RL   de Porres 4, 28035 Madrid, SPAIN
XX
DR   MD5; 7db0c76dfeb155c2fa59318cae3e5764.
DR   H-InvDB; HIT000324314_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21,3"
FT                   /isolate="L7901"
FT                   /mol_type="mRNA"
FT                   /clone_lib="L7901c"
FT                   /clone="13"
FT                   /clone="23"
FT                   /cell_line="B-LCL"
FT                   /note="allele Cw*15052"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /gene="HLA-C"
FT                   /product="alpha chain of MHC class II"
FT                   /db_xref="GOA:Q07000"
FT                   /db_xref="H-InvDB:HIT000324314_02.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*15:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07000"
FT                   /protein_id="CAA61110.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   sig_peptide     1..72
FT   mat_peptide     73..1098
XX
SQ   Sequence 1101 BP; 219 A; 338 C; 370 G; 174 T; 0 other;
     atgcgggtca tggcgccccg aaccctcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggagagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacagac tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagcca       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt gatggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//