Dbfetch

ID   X83771; SV 1; linear; genomic DNA; STD; HUM; 272 BP.
XX
AC   X83771;
XX
DT   31-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   H.sapiens HLA-A30 variant DNA (exon 3)
XX
KW   HLA-A gene; human leukocyte antigen;
KW   major histocompatability complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02500.x.
RX   PUBMED; 8560452.
RA   Blasczyk R., Wehling J., Paessler M., Hahn U., Huhn D., Salama;
RT   "A novel HLA-A30 allele (A*3004) identified by single-strand conformation
RT   polymorphism analysis and confirmed by solid-phase sequencing";
RL   Tissue Antigens 46(4):322-326(1995).
XX
RN   [2]
RP   1-272
RA   Blasczyk R.;
RT   ;
RL   Submitted (10-JAN-1995) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dept. of Int. Medicine, Div.of Hematol. and
RL   Oncology, Univ.Hospital Rudolf Virchow, Freie Univ. , Spandauer Damm 130,
RL   D- 14050 Berlin, FRG
XX
DR   MD5; 31234d8c8298f8d66e8b4528dc0e1341.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..272
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="ASE"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>272
FT                   /codon_start=3
FT                   /product="HLA-A30 variant exon3 (alpha2 domain)"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="CAA58724.1"
FT                   /translation="SHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAA
FT                   DMAAQITQRKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQR"
XX
SQ   Sequence 272 BP; 56 A; 77 C; 98 G; 41 T; 0 other;
     gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtatga acagcacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gc                                     272
//