Dbfetch

ID   X83770; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   X83770;
XX
DT   31-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   H.sapiens HLA-A30 variant DNA (exon 2)
XX
KW   HLA-A gene; human leukocyte antigen;
KW   major histocompatability complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02500.x.
RX   PUBMED; 8560452.
RA   Blasczyk R., Wehling J., Paessler M., Hahn U., Huhn D., Salama;
RT   "A novel HLA-A30 allele (A*3004) identified by single-strand conformation
RT   polymorphism analysis and confirmed by solid-phase sequencing";
RL   Tissue Antigens 46(4):322-326(1995).
XX
RN   [2]
RP   1-266
RA   Blasczyk R.;
RT   ;
RL   Submitted (10-JAN-1995) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dept. of Int. Medicine, Div.of Hematol. and
RL   Oncology, Univ.Hospital Rudolf Virchow, Freie Univ. , Spandauer Damm 130,
RL   D- 14050 Berlin, FRG
XX
DR   MD5; 2d1fc4187488dbe66f36b5394cf850df.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="ASE"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /product="HLA-A30 variant exon2 (alpha1 domain)"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="CAA58723.1"
FT                   /translation="HSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRMEP
FT                   RAPWIEQERPEYWDQETRNVKAHSQTDRENLGTLRGYYNQSEA"
XX
SQ   Sequence 266 BP; 58 A; 80 C; 91 G; 37 T; 0 other;
     ccactccatg aggtatttct ccacatccgt gtcccggccc ggcagtggag agccccgctt        60
     catcgcagtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag       120
     ccagaggatg gagccgcggg cgccgtggat agagcaggag aggcctgagt attgggacca       180
     ggagacacgg aatgtgaagg cccactcaca gactgaccga gagaacctgg ggaccctgcg       240
     cggctactac aaccagagcg aggccg                                            266
//