Dbfetch

ID   X83727; SV 1; linear; genomic DNA; STD; HUM; 195 BP.
XX
AC   X83727;
XX
DT   31-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens HLA-B27 variant gene (exon 2)
XX
KW   HLA-B gene; human leukocyte antigen;
KW   major histocompatability complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Blasczyk R., Weber M., Salama A.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-195
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-JAN-1995) to the INSDC.
RL   R. Blasczyk, Bloodbank,Dept.of Intern. Medicine, Div of Hematol. and
RL   Oncolog., Spandauer Damm 130, Univ. Hosp. Rudolf Virchow, Freie Univ., D-
RL   14050 Berlin, FRG
XX
DR   MD5; d75742f3fec3b108cb80cf397d9dd946.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="1235"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             <76..>195
FT                   /codon_start=3
FT                   /product="HLA-B27 variant exon 2 (alpha1 domain)"
FT                   /db_xref="IMGT/HLA:B*27:05:03"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19688"
FT                   /protein_id="CAA58698.1"
FT                   /translation="IEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEA"
XX
SQ   Sequence 195 BP; 45 A; 55 C; 73 G; 22 T; 0 other;
     gctacgtgga cgacacgctg ttcgtgaggt tcgacagcga cgccgcgagt ccgagagagg        60
     agccgcgggc gccgtggata gagcaggagg ggccggagta ttgggaccgg gagacacaga       120
     tctgcaaggc caaggcacag actgaccgag aggacctgcg gaccctgctc cgctactaca       180
     accagagcga ggccg                                                        195
//