Dbfetch

ID   X83394; SV 1; linear; mRNA; STD; HUM; 1122 BP.
XX
AC   X83394;
XX
DT   14-FEB-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   H.sapiens mRNA for HLA-Cw*0704
XX
KW   HLA-C alpha chain.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02471.x.
RX   PUBMED; 7482492.
RA   Vilches C., Bunce M., de Pablo R., Herrero M.J., Kreisler M.;
RT   "Anchored PCR cloning of the novel HLA-Cw*0704 allele detected by PCR-SSP";
RL   Tissue Antigens 46(1):19-23(1995).
XX
RN   [2]
RP   1-1122
RA   Vilches C.;
RT   ;
RL   Submitted (12-DEC-1994) to the INSDC.
RL   C. Vilches, Servicio de Immunologia, Hosp. Puerta de Hierro, San Martin de
RL   Porres 4, 28035 Madrid, SPAIN
XX
DR   MD5; 733bda5730502eed9b44da3afcf78023.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
DR   H-InvDB; HIT000323951_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1122
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2, Cw* 0704, B44, DR11, DQ7 (homozygous)"
FT                   /clone_lib="KA3C"
FT                   /clone="1,2,7,8"
FT                   /cell_line="KRO3 /4 (IHW 8w141)"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             22..1122
FT                   /gene="Cw*0704"
FT                   /product="HLA-C alpha chain"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="H-InvDB:HIT000323951_03.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="CAA58313.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQDRAYLEGTCVEWLRRYLENGKKTLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   mat_peptide     94..1119
FT                   /gene="Cw*0704"
FT                   /product="HLA-C alpha chain"
XX
SQ   Sequence 1122 BP; 221 A; 353 C; 373 G; 175 T; 0 other;
     acattctccc cagaggccga gatgcgggtc atggcgcccc gagccctcct cctgctgctc        60
     tcgggaggcc tggccctgac cgagacctgg gcctgctccc actccatgag gtatttcgac       120
     accgccgtgt cccggcccgg ccgcggagag ccccgcttca tctcagtggg ctacgtggac       180
     gacacgcagt tcgtgcggtt cgacagcgac gccgcgagtc cgagagggga gccccgggcg       240
     ccgtgggtgg agcaggaggg gccggagtat tgggaccggg agacacagaa gtacaagcgc       300
     caggcacagg ctgaccgagt gagcctgcgg aacctgcgcg gctactacaa ccagagcgag       360
     gacgggtctc acaccttcca gaggatgtat ggctgcgacc tggggcccga cgggcgcctc       420
     ctccgcgggt atgaccagtt cgcctacgac ggcaaggatt acatcgccct gaacgaggac       480
     ctgcgctcct ggaccgccgc ggacaccgcg gctcagatca cccagcgcaa gttggaggcg       540
     gcccgtgcgg cggagcagga cagagcctac ctggagggca cgtgcgtgga gtggctccgc       600
     agatacctgg agaacgggaa gaagacgctg cagcgcgcgg aacccccaaa gacacacgtg       660
     acccaccacc ccctctctga ccatgaggcc accctgaggt gctgggccct gggcttctac       720
     cctgcggaga tcacactgac ctggcagcgg gatggggagg accagaccca ggacaccgag       780
     cttgtggaga ccaggccagc aggagatgga accttccaga agtgggcagc tgtggtggtg       840
     ccttctggac aagagcagag atacacgtgc catatgcagc acgaggggct gcaagagccc       900
     ctcaccctga gctgggagcc atcttcccag cccaccatcc ccatcatggg catcgttgct       960
     ggcctggctg tcctggttgt cctagctgtc cttggagctg tggtcaccgc tatgatgtgt      1020
     aggaggaaga gctcaggtgg aaaaggaggg agctgctctc aggctgcgtg cagcaacagt      1080
     gcccagggct ctgatgagtc tctcatcact tgtaaagcct ga                         1122
//