spacer

EBI Dbfetch

ID   X83003; SV 1; linear; genomic DNA; STD; HUM; 252 BP.
XX
AC   X83003;
XX
DT   09-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   H.sapiens HLA-A33 variant DNA, exon 3 (LCL82)
XX
KW   HLA-A gene; MHC class I cell surface glycoprotein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02465.x.
RX   PUBMED; 7652743.
RA   Blasczyk R., Wehling J., Hahn U., Schwella N., Huhn D., Salama A.;
RT   "Identification of a novel HLA-A33 subtype (A*3303) and correction of the
RT   A*3301 sequence";
RL   Tissue Antigens 45(5):348-352(1995).
XX
RN   [2]
RP   1-252
RA   Blasczyk R.;
RT   ;
RL   Submitted (28-NOV-1994) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dept.of Internal Medicine, Div. of Hematol.and
RL   Oncology, University Hospital Rudolf Virchow, Univ. Berlin, Spandauer Damm
RL   130, 14050 Berlin, FRG
XX
DR   MD5; fed36fd2a8fbf236a31b191678c7ed68.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..252
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="LCL 82"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>252
FT                   /note="HLA-A33 variant exon 3 ORF"
FT                   /db_xref="GOA:P16190"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*33:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16190"
FT                   /protein_id="CAA58124.1"
FT                   /translation="MYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQI
FT                   TQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQR"
XX
SQ   Sequence 252 BP; 48 A; 70 C; 97 G; 37 T; 0 other;
     atgtatggct gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc        60
     tacgacggca aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac       120
     atggcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga       180
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       240
     acgctgcagc gc                                                           252
//


spacer
spacer