Dbfetch

ID   X83002; SV 1; linear; genomic DNA; STD; HUM; 196 BP.
XX
AC   X83002;
XX
DT   09-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   H.sapiens HLA-A33 variant DNA, exon 2 (LCL82)
XX
KW   HLA-A gene; MHC class I cell surface glycoprotein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02465.x.
RX   PUBMED; 7652743.
RA   Blasczyk R., Wehling J., Hahn U., Schwella N., Huhn D., Salama A.;
RT   "Identification of a novel HLA-A33 subtype (A*3303) and correction of the
RT   A*3301 sequence";
RL   Tissue Antigens 45(5):348-352(1995).
XX
RN   [2]
RP   1-196
RA   Blasczyk R.;
RT   ;
RL   Submitted (28-NOV-1994) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dept.of Internal Medicine, Div. of Hematol.and
RL   Oncology, University Hospital Rudolf Virchow, Univ. Berlin, Spandauer Damm
RL   130, 14050 Berlin, FRG
XX
DR   MD5; 44f608e0372d2bd98cc665c90f0a5800.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..196
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="LCL 82"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>196
FT                   /codon_start=1
FT                   /note="HLA-A33 variant exon 2 ORF"
FT                   /db_xref="GOA:P16190"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*33:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16190"
FT                   /protein_id="CAA58123.1"
FT                   /translation="SVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQE
FT                   GPEYWDRNTRNVKAHSQIDR"
XX
SQ   Sequence 196 BP; 37 A; 59 C; 75 G; 25 T; 0 other;
     tccgtgtccc ggcccggccg cggggagccc cgcttcatcg ccgtgggcta cgtggacgac        60
     acgcagttcg tgcggttcga cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg       120
     tggatagagc aggaggggcc ggagtattgg gaccggaaca cacggaatgt gaaggcccac       180
     tcacagattg accgag                                                       196
//