spacer

EBI Dbfetch

ID   X82161; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   X82161;
XX
DT   30-NOV-1994 (Rel. 41, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   H.sapiens HLA-A gene, alpha 1 domain
XX
KW   alpha 1 domain; HLA-A gene; HLA-A9 variant.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1995.tb02476.x.
RX   PUBMED; 7482497.
RA   Blasczyk R., Wehling J., Kubens B.S., Hahn U., Huhn D., Salama A.;
RT   "A novel HLA-A24 allele (A*2405) identified by single-strand conformation
RT   polymorphism analysis and confirmed by solid-phase sequencing and
RT   isoelectric focusing";
RL   Tissue Antigens 46(1):54-58(1995).
XX
RN   [2]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (10-OCT-1994) to the INSDC.
RL   R. Blasczyk, Bloodbank, Dept.of Internal Medicine, Div. Hematology and
RL   Oncology, University Hospital, Rudolf Virchow, Spandauer Damm 130, 14050
RL   Berlin, FRG
XX
DR   MD5; 900f87e250e03988500e27ea14c52926.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="940074"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,X82189.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="HLA-A alpha1 and alpha2 domains"
FT                   /note="exons 2 and 3"
FT                   /db_xref="GOA:Q29841"
FT                   /db_xref="IMGT/HLA:A*24:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29841"
FT                   /protein_id="CAA57654.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /number=2
FT                   /note="label:ex2"
XX
SQ   Sequence 270 BP; 55 A; 84 C; 95 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer