Dbfetch

ID   X80331; SV 1; linear; genomic DNA; STD; HUM; 238 BP.
XX
AC   X80331;
XX
DT   17-JUL-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens MHC class II HLA DPB1 gene
XX
KW   HLA-DP B1; HLA-DP beta chain; MHC class II beta-chain.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Mersch G., Mytilineos J., Guyader A.M., De Canck I., Mijs W., Jannes,
RA   Rossau R.;
RT   "Two new DPB alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-238
RA   Mersch G.G.M.;
RT   ;
RL   Submitted (15-JUL-1994) to the INSDC.
RL   G.G.M. Mersch, Innogenetics N.V., BelgiumZwijnaardeepark, Zwijnaarde 7 box
RL   4, BELGIUM
XX
DR   MD5; da5e4632b1642a1fcfa6c0f6bb3b31fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..238
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>238
FT                   /codon_start=1
FT                   /product="beta1 domain MHC class II HLA DPB"
FT                   /note="exon2"
FT                   /db_xref="GOA:Q29777"
FT                   /db_xref="IMGT/HLA:DPB1*55:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29777"
FT                   /protein_id="CAA56581.1"
FT                   /translation="VHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELG
FT                   RPAAEYWNSQKDILEEERAVPDRMCRHNYELDEA"
XX
SQ   Sequence 238 BP; 54 A; 57 C; 91 G; 36 T; 0 other;
     gtgcaccagt tacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgctgcggag tactggaaca gccagaagga catcctggag       180
     gaggagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccg         238
//