spacer

EBI Dbfetch

ID   X75953; SV 1; linear; mRNA; STD; HUM; 1064 BP.
XX
AC   X75953;
XX
DT   25-APR-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   H.sapiens HLA-B mRNA
XX
KW   alpha-chain; HLA-B gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1994.tb02392.x.
RX   PUBMED; 7871527.
RA   Gauchat-Feiss D., Breur-Vriesendorp B.S., Rufer N., Jeannet M., Roosnek E.,
RA   Tiercy J.M.;
RT   "Sequencing of a novel functional HLA-B44 subtype differing in two residues
RT   in the alpha 2 domain";
RL   Tissue Antigens 44(4):261-264(1994).
XX
RN   [2]
RP   1-1064
RA   Tiercy J.M.;
RT   ;
RL   Submitted (17-DEC-1993) to the INSDC.
RL   J.M. Tiercy, Transplantation Immunology Unit, Lab 8252, Centre Medical
RL   Universitaire, 1, rue Michel Servet, 1211 Geneva 4, SWITZERLAND
XX
DR   MD5; 004513f237459f33d2754fc82cee380b.
DR   EuropePMC; PMC113985; 11134302.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1064
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /variety="B44.4"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-B44"
FT                   /cell_line="TAN"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>1064
FT                   /product="HLA-B alpha-chain"
FT                   /note="beta-chain"
FT                   /db_xref="GOA:Q29853"
FT                   /db_xref="H-InvDB:HIT000323556.4"
FT                   /db_xref="IMGT/HLA:B*44:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29853"
FT                   /protein_id="CAA53566.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQRRAYLEGTCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSHAACSDSAQG"
FT   exon            1..73
FT                   /number=1
FT                   /note="leader"
FT   exon            74..343
FT                   /number=2
FT                   /note="alpha 1 domain"
FT   exon            344..619
FT                   /number=3
FT                   /note="alpha 2 domain"
FT   exon            620..895
FT                   /number=4
FT                   /note="alpha 3 domain"
FT   exon            896..1012
FT                   /number=5
FT                   /note="transmembrane domain"
FT   exon            1013..1045
FT                   /number=6
FT                   /note="cytoplasmic domain"
FT   exon            1046..>1064
FT                   /number=7
FT                   /note="cytoplasmic domain"
XX
SQ   Sequence 1064 BP; 218 A; 328 C; 356 G; 162 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tcgctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggtca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcacgc tgcgtgcagc gacagtgccc aggg                       1064
//


spacer
spacer