spacer

EBI Dbfetch

ID   X75480; SV 1; linear; genomic DNA; STD; PLN; 5265 BP.
XX
AC   X75480;
XX
DT   13-APR-1994 (Rel. 39, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 19)
XX
DE   E.gunnii CAD gene.
XX
KW   cinnamyl-alcohol dehydrogenase.
XX
OS   Eucalyptus gunnii (cider tree)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Myrtales; Myrtaceae; Eucalyptus.
XX
RN   [1]
RX   DOI; 10.1007/BF00020220.
RX   PUBMED; 7727744.
RA   Feuillet C., Lauvergeat V., Deswarte C., Pilate G., Boudet A.,
RA   Grima-Pettenati J.;
RT   "Tissue- and cell-specific expression of a cinnamyl alcohol dehydrogenase
RT   promoter in transgenic poplar plants";
RL   Plant Mol. Biol. 27(4):651-667(1995).
XX
RN   [2]
RP   1-5265
RA   Grima-Pettenati J.;
RT   ;
RL   Submitted (13-OCT-1993) to the INSDC.
RL   J. Grima-Pettenati, Universite Paul Sabatier, Centre de Physiologie
RL   Vegetale, URA CNRS 1457, 118 Route de Narbonne, 31 062 Toulouse Cedex,
RL   FRANCE
XX
DR   MD5; 036c95275cc6cdf95474746da73d840d.
DR   EuropePMC; PMC3060884; 21375742.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5265
FT                   /organism="Eucalyptus gunnii"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="EMBL Sp6  /T7, Bluescript"
FT                   /clone="832 (Afocel, France)"
FT                   /db_xref="taxon:3933"
FT   regulatory      2471..2477
FT                   /regulatory_class="TATA_box"
FT   mRNA            join(2500..2704,2898..3011,3096..3323,3915..4354,
FT                   4648..>4841)
FT                   /gene="CAD"
FT                   /product="cinnamyl-alcohol dehydrogenase"
FT   exon            2500..2704
FT                   /number=1
FT   CDS             join(2616..2704,2898..3011,3096..3323,3915..4354,
FT                   4648..4841)
FT                   /gene="CAD"
FT                   /product="cinnamyl-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.195"
FT                   /db_xref="GOA:Q42726"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q42726"
FT                   /protein_id="CAA53211.1"
FT                   /translation="MGSLEKERTTTGWAARDPSGVLSPYTYSLRNTGPEDLYIKVLSCG
FT                   ICHSDIHQIKNDLGMSHYPMVPGHEVVGEVLEVGSEVTKYRVGDRVGTGIVVGCCRSCS
FT                   PCNSDQEQYCNKKIWNYNDVYTDGKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMC
FT                   AGVTVYRPLVRFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRTEALE
FT                   HLGADAYLVSSDENGMKEATDSLDYVFDTIPVVHPLEPYLALLKLDGKLILTGVINAPL
FT                   QFISPMVMLESITGSFIGSMKETEEMLEFCKEKGLTSQIEVIKMDYVNTALERLEKNDV
FT                   RYRFVVDVVGSKLD"
FT   intron          2705..2897
FT                   /number=1
FT   exon            2898..3011
FT                   /number=2
FT   intron          3012..3095
FT                   /number=2
FT   exon            3096..3323
FT                   /number=3
FT   intron          3324..3914
FT                   /number=3
FT   exon            3915..4354
FT                   /number=4
FT   intron          4355..4647
FT                   /number=4
FT   exon            4648..>4841
FT                   /number=5
FT   regulatory      5011..5017
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 5265 BP; 1429 A; 1109 C; 1187 G; 1540 T; 0 other;
     ggatccgcct ccagagatag agacaatccg tctcttcaca gtgattgagc aagtacccac        60
     atcaatcact tagaatatag agaaaagata cttggcagta ggccccagtt tcgactgctt       120
     gacctaggga ctctaactcc agctgagcag agacccagga tgctgctatt taaagtcacc       180
     aggggactca gtatttcggc acgccacttg cccaccaaaa cacgcacagc catcttcgtt       240
     agaaaccctc gcccaagtcc cacaattcat ttctcacttg catgagatgg caagatcaag       300
     cgcctctctc acttcagctc ttctgcttct tctcctgatg acttgtgctg tgttcaagac       360
     tgaagctaga tcactcaaga gcatcgccac cgacttgcct ggctcgttga acggttcgat       420
     ctcaacatca cgatcaagcg ctcagggccg agccagcggt cccgggcaca agtacaggaa       480
     gctggcccaa ttcatcgggt ggaccaaaag atctggccct agcccaggcg ttgggcacta       540
     gtgtcattaa tccactagtc tcagtttgtt cgtggtgatt cttagctaat ctcatcctcg       600
     aatcccatca gtttgtgtat tacttaaatc gcacttctag tcattcaacg tcacaactta       660
     taacagatcc gtgaactgat gttatatata tacgacaata ttacttcgaa actattatac       720
     aacatgtatt attgtaacgt caaacctcta catagttatt caaaatgtaa tgtggcagta       780
     gtaatagtac cagtcatgta tccaacacat tttcctcgta tttctatatt tcatgtcagt       840
     attacgacac atgctataga atgtgacaat agtttggctc aatgaaatcc catttccttt       900
     ataagtatct caagttttgc tgatctctct ctcggaaggc tccaccaaga gtttctgtca       960
     tttacaattg aagttgatat gatataagtt gtggatcagc aagaacccgg cccaagggaa      1020
     aagaagggcc tttcatctta ttgggcttcc agctctaaca gcagaaagag cccaaaaatt      1080
     cctggttttg ggccttcgag gttcaatctt acagcccata atggaatgca gctcttatcc      1140
     gatcgataat ttctttgact cattctattt ttgaaagaaa aggaaaaagg acagatccag      1200
     agagacttgt tcttcaccta ctacagatct gatcatgaaa gttggcaagt catttgcaat      1260
     gtctacatta gagataaagt acattaacac atcgtatcgc ctttgacaat aatattattt      1320
     tatatgttca aggcctactc caacaacccc gccgaggcac gtcccttcca aagccacgtt      1380
     ctctgacgcc ctattgaaaa gtaaacgatt ggacggacaa ttcggcacgt attcgaagaa      1440
     ttatatttgt ggtgagccag agaagatttt agggaattct cttctggttg ggcaggttct      1500
     tgtcaatcga aaatttgaac gaagagggga tgaggtgggg aggaaatatc ttgagtccca      1560
     tggaagaggg agaagagtct ctttcccgat gcattttctt gaactattca gacatggttg      1620
     gcgtgaagga ggaggagcgg acggcttgga aattttttgt gtttggtttt gtcgttgcca      1680
     aagtccaatc ttgcaaatat atttaaaaca gattgtttta gattgataac gtgttcctat      1740
     cattccggca ttcatctcat tcttgaatta tataagagca ttgagtataa aatttaagtt      1800
     acggacgaat ggcaaagcag acctagtgag aaaattagta taatcacaat aaaaatatcc      1860
     atatagacat cacaaaaatg ccgccccaag ccaatgaaat ccaacaaata acacaaacat      1920
     atatatgtcc aagacttgga ctccaagtcg acatgcttgt gcatgcacaa ttttgggcca      1980
     taaaattggg catgtgagag cctcgaaccg ttaagagatt aggcatttac tttgtttgtc      2040
     gactggcgag acgtgcacgc attttacacc ctcttctcat tggatcttca aagcttttct      2100
     gaactcacga tggttccaga aaggcgatgt tttgctgaca gatggagcgt tcgatggagc      2160
     ttctccatca cttaatttgt cccttcaaga tgaaaaaagt aagaggtcca ctgtaccaaa      2220
     acattcttcc acccagaaga aaaccacagt agctggaggg agtcaagcat gtcagaagca      2280
     cagaaactgg gaatggctaa aaagcaagtc ttgaccctta acccacccca ctggttcacc      2340
     taccgcacct ctggttaggt attgcttgct gaggtgtcac ttttcgccaa agtcacgtct      2400
     ctcttttgga ttcttcctat tggtccgtct ctttcctcgt tgctggttgc tggtagcgtt      2460
     tttgtccaaa tatatatgca gtccatatgt atccccgtca ctcctcatct atgctcctac      2520
     ccggcaactt cccactacga taagagcaag tttatggctc tgtcgaatct ctctccgagc      2580
     accactttga aagaagcttg gatctttgag caaaaatggg cagtcttgag aaggagagga      2640
     ccaccacggg ttgggctgca agggacccgt ctggcgttct ctctccttac acttatagcc      2700
     tcaggtagat tcaagaactt gccttcttca ggattgataa agatagctaa gaatctaagt      2760
     tttcgctgtg cttgtgatgt cgtcttttaa ttcttgtttt tgcttgttcg atcaattacg      2820
     cattaatcaa tattcgattg attggtctga ggttatcaac aaaaaagatt tgtctaagtc      2880
     acttccaaca aatgcagaaa cacgggacca gaagatcttt acatcaaggt gttgagctgc      2940
     gggatttgcc acagtgacat tcaccagatc aagaatgatc ttggcatgtc ccactaccct      3000
     atggttcctg ggtaggtctt ttcttgcatt aatcatgact gattcttctc gtctgtgttt      3060
     cttcatattc taattattct ttccctcttt ttcaggcatg aagtggtggg tgaggttctg      3120
     gaggtgggat cagaggtgac aaagtacaga gttggtgacc gagtgggaac cggtatagtg      3180
     gttgggtgct gcagaagctg tagcccttgc aattcggacc aggagcaata ttgcaacaag      3240
     aagatttgga attacaatga cgtgtacacc gatggcaagc ccactcaagg tgggtttgct      3300
     ggtgagatag tggttggcga aaggtgagcc cttgcatgcc tctctctacc tcttatctaa      3360
     ctgaaatcgc ctacctaacg gggggagagt ttgatgatcc ctcgaggaga ccttgcctgt      3420
     gtggaatttt gccattggat ggaaaagcaa aatatgaaaa actgtccggg ttgagtatgt      3480
     tgtacttcaa tccaatggtg aaagaatgcg agggcaccat gcccccatct acttagagta      3540
     gatcgaaaag tgggcatcct ttgtttgagc ccttccattg ttgattcatt caattgcagt      3600
     taatttgtct tgggtcaatc ttaatggccc acaaaatcac attcaacttg atgaacaata      3660
     atcagaaaga aacatgtctg gtcttgtcaa ttttagctct taagtacttc gaatggcatg      3720
     acttgatttg atggtgtatt gtaaatttag taaactagtt ggcgaacttg aaggtctggg      3780
     aattagttaa gtggaatgac ataggaaaga cacatgacta gcctaagcta acttctggag      3840
     cattgcatgt aaacccgtac aaagtgaaac tgatggaaga tttgactggt ccaattgggt      3900
     cctttgccct tcaggtttgt ggtgaaaatc cctgatgggt tagagtcgga acaggcagcg      3960
     ccgctaatgt gcgctggtgt gaccgtgtac aggcctctgg tgcgctttgg gctcaagcaa      4020
     agtgggctga gaggagggat actggggctt ggaggggttg gccacatggg ggtgaagata      4080
     gccaaggcca tgggacacca tgtgactgtg ataagctctt ctgataagaa gagaacggag      4140
     gcattggagc acctgggtgc cgatgcttac ctagtgagct ccgatgaaaa tggaatgaaa      4200
     gaggccactg attcgctcga ctacgttttt gacactatcc ctgtggttca ccctctcgaa      4260
     ccttacctgg ccttgttgaa gctcgatggg aagctgatct tgactggtgt catcaatgct      4320
     cctcttcaat ttatctctcc catggttatg cttggtaaat tctctatctc cctttctctt      4380
     gagcgctgtt ttttgaatgg attagtccat cgatcaatga agtcatacgg accgcatcga      4440
     caaggaaatt tatacaccgt gtacatatga aaatccattg tgaagccttg catattactc      4500
     taaatggcta tacatcattt tgtgatcacg gtctgatgtt tttttgctgg cattttgcga      4560
     acaaatcgaa aatcttctct tggattgacg gtctttcaaa gaaattgtat gtcacctcat      4620
     ttgtgtggtt ataacatgca gggaggaagt caatcactgg gagtttcata gggagcatga      4680
     aggaaacaga ggagatgctt gagttctgca aagaaaaggg attgacttcc cagatcgaag      4740
     tgatcaagat ggattatgtc aacacggccc tagagaggct cgagaagaat gatgtcaggt      4800
     acaggtttgt cgtggacgtc gtgggaagca agcttgatta gttttttcct ttccccataa      4860
     ttaaacaaga aatcgacgtg cttgtctctc aattcgagtt cctcatgccc tctgttgtat      4920
     cattgtttgt tataccgaga gtgctatttt cttctgtctt cgtattgaaa ccatagacct      4980
     tctcgattgt gtattcaatg atgaaggtgt taatgatttt atcacttaag aaatttgact      5040
     atttggattc tggaagactt ttgaattggg ttgtgctgtg ttttcaagcg gggtgggtga      5100
     gggttctctt ttttgacagt gacacaatgt atttcacaat tcttggtgga tacgactctt      5160
     tgatagggtg ctcaccagct tttcctaagt tagcaaaggt cacatcgctt cacattggag      5220
     ccattatccc aagtgagcac aaagtaagat aaaagagtag agggg                      5265
//


spacer
spacer