Dbfetch

ID   X75441; SV 1; linear; genomic DNA; STD; HUM; 240 BP.
XX
AC   X75441;
XX
DT   01-JAN-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 22)
XX
DE   H.sapiens MHC class II HLA-DRB1 gene exon-2, difference with DRB1*0301
DE   exon-2 (codon 37).
XX
KW   HLA-DRB1 gene; MHC classII HLA-DRB1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-240
RA   Verduijn W.;
RT   ;
RL   Submitted (12-OCT-1993) to the INSDC.
RL   W. Verduijn, Immunohaematology & Bloodbank, University Hospital, Postbox
RL   9600, 2300 RC Leiden, NETHERLANDS
XX
RN   [3]
RP   1-240
RX   DOI; 10.1016/0198-8859(94)00072-X.
RX   PUBMED; 7751156.
RA   Anholts J.D.H., Verduijn W., Parlevliet A., Doxiadis I.I., D'Amaro J.,
RA   Giphart M.J., Persijn G.G., Schreuder G.M.;
RT   "Irregular polymerase chain reaction-sequence-specific oligonucleotide
RT   hybridization patterns reveal seven new HLA-DRB1 alleles related to DR2,
RT   DR3, DR6, DR8, and DR11. Implications for sequence-specific priming";
RL   Hum. Immunol. 42(1):15-22(1995).
XX
DR   MD5; 7dbeccd24c2b937df789a304ba4323ef.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..240
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="MIT-3758"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   misc_feature    1..189
FT                   /gene="MHC class II HLA-DRB1 Exon-2"
FT                   /note="homology with human DRB1*0301"
FT   CDS             <1..>240
FT                   /codon_start=1
FT                   /gene="MHC class II HLA-DRB1 Exon-2"
FT                   /db_xref="GOA:Q29957"
FT                   /db_xref="IMGT/HLA:DRB1*03:04:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29957"
FT                   /protein_id="CAA53193.1"
FT                   /translation="LEYSTSECHFFNGTERVRYLDRYFHNQEESVRFDSDVGEFRAVTE
FT                   LGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVE"
FT   variation       88..89
FT                   /note="sequence has 2 base pairs difference with DRB1*0301
FT                   exon 2"
FT   misc_feature    90..240
FT                   /gene="MHC class II HLA-DRB1 Exon-2"
FT                   /note="homology with human DRB1*0301"
XX
SQ   Sequence 240 BP; 51 A; 56 C; 89 G; 44 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggtacctg        60
     gacagatact tccataacca ggaggagtcc gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gccgagtact ggaacagcca gaaggacctc       180
     ctggagcaga agcggggccg ggtggacaac tactgcagac acaactacgg ggttgtggag       240
//