spacer

EBI Dbfetch

ID   X73578; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   X73578;
XX
DT   06-JUL-1993 (Rel. 36, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 17)
XX
DE   H. sapiens HLA-B*2706 mRNA
XX
KW   HLA-B gene; HLL-B*2706.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1007/BF00241265.
RX   PUBMED; 8276469.
RA   Vilches C., de Pablo R., Kreisler M.;
RT   "Nucleotide sequence of HLA-B*2706";
RL   Immunogenetics 39(3):219-219(1994).
XX
RN   [2]
RC   revised by [3]    MAT
RA   Vilches C.;
RT   ;
RL   Submitted (25-JUN-1993) to the INSDC.
RL   C. Vilches, Hospital Puerta de Hierro, Servicio de Immunologia, San Martin
RL   de Porres 4, 28035 Madrid, SPAIN
XX
RN   [3]
RP   1-1089
RA   Vilches C.;
RT   ;
RL   Submitted (05-SEP-1995) to the INSDC.
RL   C. Vilches, Hospital Puerta de Hierro, Servicio de Immunologia, San Martin
RL   de Porres 4, 28035 Madrid, SPAIN
XX
DR   MD5; 222e1d595b06252088990ae6dcb23fe4.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
DR   H-InvDB; HIT000323377_03.4.
XX
CC   Related sequence: Vega, M.A., J. Immunol. 137:3557-3565 (86)
CC   
CC   Sequence differs from the published sequence at position 704
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /isolate="PAR"
FT                   /mol_type="mRNA"
FT                   /clone_lib="cDNA PAR-B"
FT                   /clone="1,2,8,11"
FT                   /cell_line="PAR HLA phenotype A11/24, B27 /48, DR11 /15,
FT                   DQ5/7"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /gene="HLA-B"
FT                   /product="HLA-B alpha chain (B*2706)"
FT                   /note="alpha/beta-2-microglobulin"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="H-InvDB:HIT000323377_02.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="CAA51980.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDRESLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPGEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   misc_feature    74..343
FT                   /note="alpha 1 domain"
FT   mat_peptide     74..1086
FT                   /product="HLA-B alpha chain"
FT   sig_peptide     74..1086
FT   misc_feature    344..619
FT                   /note="alpha 2 domain"
FT   misc_feature    620..895
FT                   /note="alpha 3 domain"
FT   misc_feature    896..1012
FT                   /note="transmembrane domain"
FT   misc_feature    1013..1086
FT                   /note="cytoplasmic domain"
XX
SQ   Sequence 1089 BP; 217 A; 330 C; 369 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggctccca ctccatgagg tatttccaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tgcaaggcca aggcacagac tgaccgagag       300
     agcctgcgga ccctgctccg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aatatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctggggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer