spacer

EBI Dbfetch

ID   X73027; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   X73027;
XX
DT   27-APR-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   H.sapiens gene for HLA-DR1 beta chain
XX
KW   HLA-DR Beta.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1993.tb02187.x.
RX   PUBMED; 8284792.
RA   Middleton D.C., Hughes D.J., Trainor F., Graham C.A., Martin J.,
RA   Savage D.A.;
RT   "A new DRB1 allele DRB1*1107--a combination of DRB1*11 and DRB1*03";
RL   Tissue Antigens 42(3):160-163(1993).
XX
RN   [2]
RP   1-255
RA   Middleton D.C.;
RT   ;
RL   Submitted (23-APR-1993) to the INSDC.
RL   D.C. Middleton, Tissue Typing Laboratory, Belfast City Hospital, Lisburn
RL   Road, Belfast BT9 7AD, IRELAND
XX
DR   MD5; 448824fbbc0a08eed4b14e3996366d9e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="BELKG(2375)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A2,B49,Cw7"
FT                   /cell_type="leucocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="HLADRB1"
FT                   /product="HLA-DR beta chain"
FT                   /db_xref="GOA:Q07493"
FT                   /db_xref="IMGT/HLA:DRB1*11:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q07493"
FT                   /protein_id="CAA51510.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQ"
XX
SQ   Sequence 255 BP; 57 A; 56 C; 93 G; 49 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tctataacca agaggagtac gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gaggagtact ggaacagcca gaaggacctc       180
     ctggagcaga agcggggccg ggtggacaac tactgcagac acaactacgg ggttgtggag       240
     agcttcacag tgcag                                                        255
//


spacer
spacer