Dbfetch

ID   X70857; SV 1; linear; mRNA; STD; HUM; 1112 BP.
XX
AC   X70857;
XX
DT   26-FEB-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   H.sapiens mRNA for HLA-Cw*0602
XX
KW   beta-2-microglobulin; HLA-C alpha chain.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1016/0198-8859(93)90509-Y.
RX   PUBMED; 7905471.
RA   Vilches C., de Pablo R., Herrero M.J., Moreno M.E., Kreisler M.;
RT   "Molecular cloning and polymerase chain reaction-sequence-specific
RT   oligonucleotide detection of the allele encoding the novel allospecificity
RT   HLA-Cw6.2 (Cw*1502) in Spanish gypsies";
RL   Hum. Immunol. 37(4):259-263(1993).
XX
RN   [2]
RP   1-1112
RA   Vilches C.;
RT   ;
RL   Submitted (29-JAN-1993) to the INSDC.
RL   C. Vilches, Servicio de Inmunologia, Hospital Puerta de Hierro, San Martin
RL   de Porres 4, 28035 Madrid, SPAIN
XX
DR   MD5; 40bf527fe632c62fb5594dab874023e4.
XX
CC   HLA phenotype: A1,11 Cw6, BL B17,61 DR3,11 DQ2,7
CC   Cell line G088
CC   Related sequence: M28206
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1112
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="G088"
FT                   /mol_type="mRNA"
FT                   /clone_lib="G085C"
FT                   /clone="6,9,12,13"
FT                   /cell_line="2088"
FT                   /cell_type="B-LCL"
FT                   /tissue_type="FROM PBMC"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     5..76
FT                   /gene="HLAC"
FT   CDS             5..1105
FT                   /gene="HLAC"
FT                   /product="HLA-C alpha chain"
FT                   /db_xref="GOA:P30508"
FT                   /db_xref="H-InvDB:HIT000323112.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*06:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30508"
FT                   /protein_id="CAA50210.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   mat_peptide     77..1102
FT                   /gene="HLAC"
FT                   /product="HLA-C alpha chain"
XX
SQ   Sequence 1112 BP; 220 A; 341 C; 377 G; 174 T; 0 other;
     cgagatgcgg gtcatggcgc cccgaaccct catcctgctg ctctcgggag ccctggccct        60
     gaccgagacc tgggcctgct cccactccat gaggtatttc gacaccgccg tgtcccggcc       120
     cggccgcgga gagccccgct tcatctcagt gggctacgtg gacgacacgc agttcgtgcg       180
     gttcgacagc gacgccgcga gtccgagagg ggagccccgg gcgccgtggg tggagcagga       240
     ggggccggag tattgggacc gggagacaca gaagtacaag cgccaggcac aggctgaccg       300
     agtgaacctg cggaaactgc gcggctacta caaccagagc gaggacgggt ctcacaccct       360
     ccagtggatg tatggctgcg acctggggcc cgacgggcgc ctcctccgcg ggtatgacca       420
     gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc       480
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       540
     gtggagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg       600
     gaaggagacg ctgcagcgcg cggaacaccc aaagacacac gtgacccacc atcccgtctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccaggcc       780
     agcaggagat ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacacg tgccatgtgc agcacgaggg gctgccagag cccctcaccc tgagatggga       900
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc       960
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      1020
     tggaaaagga gggagctgct ctcaggctgc gtccagcaac agtgcccagg gctctgatga      1080
     gtctctcatc gcttgtaaag cctgagacag ct                                    1112
//