Dbfetch

ID   X68272; SV 1; linear; genomic DNA; STD; HUM; 250 BP.
XX
AC   X68272; S58427;
XX
DT   13-FEB-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   H.sapiens DNA for HLA-DRB1 exon 2 (allele DR4x11)
XX
KW   HLA class II B locus allele; HLA-DR beta chain; HLA-DRB1 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]   MAT
RA   Tiercy J.M.;
RT   ;
RL   Submitted (17-JUN-1992) to the INSDC.
RL   J.-M. Tiercy, Transplantation Immunology Unit, Centre Medical
RL   Universitaire-Lab 8252, 1 rue Michel Servet, 1211 Geneva 4, SWITZERLAND
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1993.tb01986.x.
RX   PUBMED; 8475495.
RA   Tiercy J.M., Gebuhrer L., Betuel H., Mach B., Jeannet M.;
RT   "A new HLA-DR4 allele with a DR11 alpha-helix sequence";
RL   Tissue Antigens 41(2):97-101(1993).
XX
RN   [3]
RP   1-250
RA   Tiercy J.M.;
RT   ;
RL   Submitted (11-SEP-1995) to the INSDC.
RL   J.-M. Tiercy, Transplantation Immunology Unit, Centre Medical
RL   Universitaire-Lab 8252, 1 rue Michel Servet, 1211 Geneva 4, SWITZERLAND
XX
DR   MD5; db1c0b3fa6ee0ffba4ebe2abc50daae4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..250
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="locus HLA-DBR1"
FT                   /isolate="patients NIC and HOU"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-DR4"
FT                   /note="Allele: HLA-DRB1*0415"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>250
FT                   /gene=" HLA-DBR1"
FT                   /product="HLA-DRbeta-chain"
FT                   /note="received with codon_start=2"
FT   CDS             <1..>250
FT                   /codon_start=3
FT                   /gene=" HLA-DBR1"
FT                   /product="HLA-DRbeta-chain"
FT                   /db_xref="GOA:Q29895"
FT                   /db_xref="IMGT/HLA:DRB1*04:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29895"
FT                   /protein_id="CAA48333.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVE"
XX
SQ   Sequence 250 BP; 57 A; 56 C; 91 G; 46 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag                                                              250
//