spacer

EBI Dbfetch

ID   X67818; SV 1; linear; mRNA; STD; HUM; 1112 BP.
XX
AC   X67818;
XX
DT   03-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   H.sapiens mRNA for HLA-Cw*1502
XX
KW   HLA-C alpha chain; HLA-C gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1112
RA   Vilches C.;
RT   ;
RL   Submitted (26-OCT-1992) to the INSDC.
RL   C. Vilches, Servicio de Inmunologia, Hospital Puerta de Hierro, San Martin
RL   de Porres 4, 28035 Madrid, SPAIN
XX
RN   [3]
RP   1-1112
RX   DOI; 10.1016/0198-8859(93)90509-Y.
RX   PUBMED; 7905471.
RA   Vilches C., de Pablo R., Herrero M.J., Moreno M.E., Kreisler M.;
RT   "Molecular cloning and polymerase chain reaction-sequence-specific
RT   oligonucleotide detection of the allele encoding the novel allospecificity
RT   HLA-Cw6.2 (Cw*1502) in Spanish gypsies";
RL   Hum. Immunol. 37(4):259-263(1993).
XX
DR   MD5; ca3c8e87d31baffccb3c9e960a62d6bc.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
DR   H-InvDB; HIT000322877_03.4.
XX
CC   Related sequences:M24096 & Watkins, D.I., Nature. 357:329-333
CC   (1992)
CC   
CC   Cell line: G085
CC   HLA phenotype: A1,29 Cw6.2,blank B52,61 DR,15 DQ5,6
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1112
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /isolate="GO85"
FT                   /mol_type="mRNA"
FT                   /clone_lib="cDNA GO85C"
FT                   /clone="1,4,9,19"
FT                   /cell_line="2085(HLA-A1,29 Cw6sh,BL B52,61 DR14,15 DQ5,6)"
FT                   /cell_type="B-LCL"
FT                   /tissue_type="from PBMC"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     5..76
FT   CDS             5..1105
FT                   /gene="HLA-C"
FT                   /product="HLA-C alpha chain"
FT                   /db_xref="GOA:Q07000"
FT                   /db_xref="H-InvDB:HIT000322877_02.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*15:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="CAA48029.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   mat_peptide     77..1102
FT                   /gene="HLA-C"
FT                   /product="HLA-C alpha chain"
FT   misc_feature    77..346
FT                   /note="alpha 1 domain"
FT   misc_feature    347..622
FT                   /note="alpha 2 domain"
FT   misc_feature    623..898
FT                   /note="alpha 3 domain"
FT   misc_feature    899..1018
FT                   /note="transmembrane domain"
FT   misc_feature    1019..1105
FT                   /note="cytoplasmic domain"
XX
SQ   Sequence 1112 BP; 223 A; 340 C; 374 G; 175 T; 0 other;
     cgagatgcgg gtcatggcgc cccgaaccct cctcctgctg ctctcgggag ccctggccct        60
     gaccgagacc tgggcctgct cccactccat gaggtatttc tacaccgctg tgtcccggcc       120
     cggccgcgga gagccccact tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg       180
     gttcgacagc gacgccgcga gtccaagagg ggagccgcgg gcgccgtggg tggagcagga       240
     ggggccggag tattgggacc gggagacaca gaactacaag cgccaggcac agactgaccg       300
     agtgaacctg cggaaactgc gcggctacta caaccagagc gaggccgggt ctcacatcat       360
     ccagaggatg tatggctgcg acctggggcc cgacgggcgc ctcctccgcg ggcatgacca       420
     gttagcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc       480
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       540
     gctgagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg       600
     gaaggagacg ctgcagcgcg cggaacaccc aaagacacac gtgacccacc atcccgtctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccaggcc       780
     agcaggagat ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacacg tgccatgtgc agcacgaggg gctgccggag cccctcaccc tgagatggga       900
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc       960
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      1020
     tggaaaagga gggagctgct ctcaggctgc gtccagcaac agtgcccagg gctctgatga      1080
     gtctctcatc gcttgtaaag cctgagacag ct                                    1112
//


spacer
spacer