spacer

EBI Dbfetch

ID   X65031; SV 1; linear; genomic DNA; STD; HUM; 282 BP.
XX
AC   X65031;
XX
DT   09-APR-1992 (Rel. 31, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   H.sapiens major histocompatibility complex gene HLA-DR4Dw10.2
XX
KW   cell surface glycoprotein; HLA antigen; HLA-DR4Dw10.2;
KW   HLA-DRB1*0402 homologue.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RA   Pile K.;
RT   ;
RL   Submitted (11-MAR-1992) to the INSDC.
RL   K. Pile, Institute of Molecular Medicine, John Radcliffe Hospital,
RL   Molecular Immunology Group, Headington, Oxford OX3 9DU, UK
XX
RN   [3]
RP   1-282
RX   DOI; 10.1016/0198-8859(91)90027-7.
RX   PUBMED; 1909694.
RA   Marsh S.G.E., Bodmer J.G.;
RT   "HLA class II nucleotide sequences, 1991";
RL   Hum. Immunol. 31(3):207-227(1991).
XX
RN   [4]
RX   DOI; 10.1111/j.1399-0039.1992.tb02056.x.
RX   PUBMED; 1481204.
RA   Pile K.D., Willcox N., Bell J.I., Wordsworth B.P.;
RT   "A novel HLA-DR4 allele (DRB1*0414) in a patient with myasthenia gravis";
RL   Tissue Antigens 40(5):264-266(1992).
XX
DR   MD5; 32cd930d7420f10a8bd9cfdf7592ea56.
XX
CC   Related sequences: Marsh, S.G.E. and Bodmer, J.E., Human
CC   Immunology, 31:207-227 (1991). Identical to HLA-DRB1*0402 apart
CC   from base "g" instead of "t" at 257 giving Gly rather than Val.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="Patient M50"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="extracted genomic DNA from PBL"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /product="HLA-DR4Dw10.2"
FT                   /note="gene similar to HLA-DRB1*0402"
FT                   /db_xref="GOA:Q29888"
FT                   /db_xref="IMGT/HLA:DRB1*04:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29888"
FT                   /citation=[3]
FT                   /protein_id="CAA46165.1"
FT                   /translation="GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   misc_difference 257
FT                   /replace="t"
FT                   /note="similar to HLA-DRB1*0402"
FT                   /citation=[3]
XX
SQ   Sequence 282 BP; 64 A; 69 C; 101 G; 48 T; 0 other;
     ggggacaccc gaccacgttt cttggagcag gttaaacatg agtgtcattt cttcaacggg        60
     acggagcggg tgcggttcct ggacagatac ttctatcacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacat cctggaagac gagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc ga                          282
//


spacer
spacer