spacer

EBI Dbfetch

ID   X64366; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   X64366;
XX
DT   21-FEB-1992 (Rel. 31, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   H.sapiens HLA-B*4403 mRNA for leucocyte antigen (HLA) class I molecule
XX
KW   HLA-B*4403 gene; leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Fleischhauer K.L.;
RT   ;
RL   Submitted (30-JAN-1992) to the INSDC.
RL   K.L. Fleischhauer, Memorial Sloan Kettering Cancer Center, 1275 York
RL   Avenue, New York NY 10021, USA
XX
RN   [2]
RP   1-1089
RX   DOI; 10.1111/j.1399-0039.1991.tb01859.x.
RX   PUBMED; 1871765.
RA   Fleishchhauer K., Kernan N.A., Dupont B., Yang S.Y.;
RT   "The two major subtypes of HLA-B44 differ for a single amino acid in codon
RT   156";
RL   Tissue Antigens 37(3):133-137(1991).
XX
DR   MD5; 9aca85a491e3c36464144587347c6147.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /gene="HLA-B*4403"
FT                   /product="leukocyte antigen (HLA) class I  molecule"
FT                   /db_xref="GOA:P30481"
FT                   /db_xref="H-InvDB:HIT000322689.11"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*44:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1M6O"
FT                   /db_xref="PDB:1N2R"
FT                   /db_xref="PDB:1SYS"
FT                   /db_xref="PDB:1SYV"
FT                   /db_xref="PDB:3DX6"
FT                   /db_xref="PDB:3DX7"
FT                   /db_xref="PDB:3DX8"
FT                   /db_xref="PDB:3DXA"
FT                   /db_xref="PDB:3KPL"
FT                   /db_xref="PDB:3KPM"
FT                   /db_xref="PDB:3KPN"
FT                   /db_xref="PDB:3KPO"
FT                   /db_xref="PDB:3KPP"
FT                   /db_xref="PDB:3KPQ"
FT                   /db_xref="PDB:3KPR"
FT                   /db_xref="PDB:3KPS"
FT                   /db_xref="PDB:3L3D"
FT                   /db_xref="PDB:3L3G"
FT                   /db_xref="PDB:3L3I"
FT                   /db_xref="PDB:3L3J"
FT                   /db_xref="PDB:3L3K"
FT                   /db_xref="PDB:4JQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30481"
FT                   /protein_id="CAA45718.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            1..73
FT                   /number=1
FT   exon            74..343
FT                   /number=2
FT   exon            344..619
FT                   /number=3
FT   exon            620..895
FT                   /number=4
FT   exon            896..1012
FT                   /number=5
FT   exon            1013..1045
FT                   /number=6
FT   exon            1046..1089
FT                   /number=7
XX
SQ   Sequence 1089 BP; 221 A; 333 C; 361 G; 174 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tcgctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggtca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcattg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer