Dbfetch

ID   X61709; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   X61709;
XX
DT   18-SEP-1991 (Rel. 29, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 16)
XX
DE   Human RNA for HLA-Bw72 antigen
XX
KW   major histocompatibility complex; major histocompatibility complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Madrigal J.A.;
RT   ;
RL   Submitted (27-AUG-1991) to the INSDC.
RL   J.A. Madrigal, Stanford University, Dept of Cell Biology, Sherman Fairchild
RL   Bldg, Stanford CA 94305, USA
XX
RN   [2]
RP   1-1089
RX   PUBMED; 1431115.
RA   Madrigal J.A., Belich M.P., Hildebrand W.H., Benjamin R.J., Little A.M.,
RA   Zemmour J., Ennis P.D., Ward F.E., Petzl-Erler M.L., du Toit E.D.,
RA   Parham P.;
RT   "Distinctive HLA-A,B antigens of black populations formed by interallelic
RT   conversion";
RL   J. Immunol. 149(10):3411-3415(1992).
XX
RN   [3]
RP   1-1089
RX   DOI; 10.1111/j.1399-0039.1993.tb02196.x.
RX   PUBMED; 8146861.
RA   Domena J.D., Little A.M., Madrigal A.J., Hildebrand W.H., Johnston-Dow L.,
RA   du Toit E., Bias W.B., Parham P.;
RT   "Structural heterogeneity in HLA-B70, a high-frequency antigen of black
RT   populations";
RL   Tissue Antigens 42(5):509-517(1993).
XX
DR   MD5; e605121a7749cda44fa35b2b79b2f228.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="CC"
FT                   /cell_type="B-lymphoblastoid (EBV transformed)"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /product="HLA-Bw72 antigen"
FT                   /db_xref="GOA:P30464"
FT                   /db_xref="H-InvDB:HIT000322491.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*15:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30464"
FT                   /protein_id="CAA43878.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 222 A; 336 C; 361 G; 170 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//