Dbfetch

ID   X61704; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   X61704;
XX
DT   18-SEP-1991 (Rel. 29, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human RNA for HLA-Aw34.1 antigen
XX
KW   major histocompatibility complex; major histocompatibility complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RA   Madrigal J.A.;
RT   ;
RL   Submitted (27-AUG-1991) to the INSDC.
RL   J.A. Madrigal, Stanford University, Dept of Cell Biology, Sherman Fairchild
RL   Bldg, Stanford CA 94305, USA
XX
RN   [2]
RP   1-1098
RX   PUBMED; 1431115.
RA   Madrigal J.A., Belich M.P., Hildebrand W.H., Benjamin R.J., Little A.M.,
RA   Zemmour J., Ennis P.D., Ward F.E., Petzl-Erler M.L., du Toit E.D.,
RA   Parham P.;
RT   "Distinctive HLA-A,B antigens of black populations formed by interallelic
RT   conversion";
RL   J. Immunol. 149(10):3411-3415(1992).
XX
DR   MD5; 70a56a91d174a9b1dfee15db022fc4b8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="ENA"
FT                   /cell_type="B-lymphoblastoid (EBV transformed)"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /product="HLA-Aw34.1 antigen"
FT                   /db_xref="GOA:P30453"
FT                   /db_xref="H-InvDB:HIT000322486.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*34:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30453"
FT                   /protein_id="CAA43873.1"
FT                   /translation="MAIMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRKVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGILAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
XX
SQ   Sequence 1098 BP; 219 A; 328 C; 371 G; 180 T; 0 other;
     atggccatca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacggaaa gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     aggatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcttacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggagacgg cccatgaggc ggagcagtgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaag acacatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atccttgctg gcctggttct ctttggagct       960
     gtgatcgctg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//