Dbfetch

ID   X60983; SV 1; linear; genomic DNA; STD; HUM; 241 BP.
XX
AC   X60983;
XX
DT   28-SEP-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 17)
XX
DE   H.sapiens gene for HLA-G alpha chain
XX
KW   antigen presentation; HLA G antigen; major histocompatibility gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-241
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (16-JUL-1991) to the INSDC.
RL   A. Arnaiz-Villena, Immunology, Hospital 12 de Octubre, CTRA Andalucia Km
RL   5.4, 28041 Madrid, SPAIN
XX
RN   [2]
RP   1-241
RX   DOI; 10.1007/BF00210473.
RX   PUBMED; 8102125.
RA   Morales P., Corell A., Martinez-Laso J., Martin-Villa J., Varela P.,
RA   Paz-Artal E., Allende L., Arnaiz-Villena A.;
RT   "Three new HLA-G alleles and their linkage disequilibria with HLA-A";
RL   Immunogenetics 38(5):323-331(1993).
XX
DR   MD5; ca350b18a616ca0c2b1d90ae101ead9f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..241
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3, 241 nuc."
FT                   /isolate="WT47, COX, DHIF"
FT                   /mol_type="genomic DNA"
FT                   /clone="5 of WT47, 2 of COX, 2 of DHIF"
FT                   /cell_line="WT47, COX, DHIF"
FT                   /cell_type="EBV-transformed B lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>241
FT                   /codon_start=2
FT                   /gene="HLA-G"
FT                   /function="antigen-presentation"
FT                   /note="exon 2 of alpha chain"
FT                   /db_xref="GOA:O19684"
FT                   /db_xref="IMGT/HLA:G*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19684"
FT                   /protein_id="CAA43298.1"
FT                   /translation="AVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQE
FT                   GPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEA"
FT   misc_feature    142
FT                   /note="polymorphic change"
XX
SQ   Sequence 241 BP; 50 A; 75 C; 88 G; 28 T; 0 other;
     cgccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga        60
     cacgcagttc gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc       120
     gtgggtggag caggaggggc cagagtattg ggaagaggag acacggaaca ccaaggccca       180
     cgcacagact gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc       240
     c                                                                       241
//