spacer

EBI Dbfetch

ID   X55710; SV 1; linear; genomic DNA; STD; HUM; 3840 BP.
XX
AC   X55710;
XX
DT   20-NOV-1990 (Rel. 25, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human HLA-A1 gene
XX
KW   HLA-A1 gene; immunoglobulin; signal peptide.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3840
RA   Girdlestone J.;
RT   ;
RL   Submitted (01-OCT-1990) to the INSDC.
RL   Girdlestone J., Medical Research Council Lab. of Mol. Biology, Hills Road ,
RL   Cambridge CB2 2QH, UK.
XX
RN   [2]
RP   1-3840
RX   DOI; 10.1093/nar/18.22.6701.
RX   PUBMED; 2251137.
RA   Girdlestone J.;
RT   "Nucleotide sequence of an HLA-A1 gene";
RL   Nucleic Acids Res. 18(22):6701-6701(1990).
XX
DR   MD5; 069df0b18aa3a52e628e84b3578eda0c.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000265434; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000583265; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3840
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CAAT_signal     445..449
FT   TATA_signal     471..475
FT   CDS             join(523..595,726..995,1236..1511,2091..2366,2469..2585,
FT                   3028..3060,3203..3250,3420..3424)
FT                   /gene="HLA-A1, MHC Class I precusor"
FT                   /product="HLA-A1 Class I Antigen precursor"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="CAA39243.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   mat_peptide     join(523..595,726..995,1236..1511,2091..2366,2469..2585,
FT                   3028..3060,3203..3250,3420..3421)
FT                   /gene="HLA-A1, MHC Class I precusor"
FT                   /product="HLA-A1 Class I Antigen precursor"
FT   exon            523..597
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=1
FT   sig_peptide     523..597
FT   intron          596..725
FT                   /number=1
FT   exon            726..995
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=2
FT   intron          996..1235
FT                   /number=2
FT   exon            1236..1511
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=3
FT   intron          1512..2090
FT                   /number=3
FT   exon            2091..2366
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=4
FT   intron          2367..2468
FT                   /number=4
FT   exon            2469..2585
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=5
FT   intron          2586..3027
FT                   /number=5
FT   exon            3028..3060
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=6
FT   intron          3061..3202
FT                   /number=6
FT   exon            3203..3250
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=7
FT   intron          3251..3419
FT                   /number=7
FT   exon            3420..3421
FT                   /gene="HLA-A1, MHC Class I"
FT                   /product="HLA-A1 Class I Antigen"
FT                   /number=8
FT   misc_signal     3422..3424
FT                   /note="termination codon"
FT   polyA_signal    3718..3724
XX
SQ   Sequence 3840 BP; 769 A; 1072 C; 1164 G; 835 T; 0 other;
     aagcttactc tctggcacca aactccatgg ggtgattttt cttctagaag agtccaggtg        60
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagataat gggatgaaaa       120
     gtgaaaggag agggacgggg cccatgccga gggtttctcc cttgtttctc agacagctcc       180
     tgggccaaga ctcagggaga cattgagaca gagcgcttcg cacaggagca gaggggtcag       240
     ggcgaagtcc cagggcccca ggcgtggctc tcagggtctc aggccccgaa ggcggtgtat       300
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       360
     caacctacgt agggtccttc atcctggata ctcacgacgc ggacccagtt ctcactccca       420
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgctgt tctaaagtcc       480
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc       540
     cgaaccctcc tcctgctact ctcgggggcc ctggccctga cccagacctg ggcgggtgag       600
     tgcggggtcg ggagggaaac cgcctctgcg gggagaagca aggggccctc ctggcggggg       660
     cgcaggaccg ggggagccgc gccgggagga gggtcgggca ggtctcagcc actgctcgcc       720
     cccaggctcc cactccatga ggtatttctt cacatccgtg tcccggcccg gccgcgggga       780
     gccccgcttc atcgccgtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga       840
     cgccgcgagc cagaagatgg agccgcgggc gccgtggata gagcaggagg ggccggagta       900
     ttgggaccag gagacacgga atatgaaggc ccactcacag actgaccgag cgaacctggg       960
     gaccctgcgc ggctactaca accagagcga ggacggtgag tgaccccggc ccgggcgcag      1020
     gtcacgaccc ctcatccccc acggacgggc caggtcgccc acagtctccg ggtccgagat      1080
     ccaccccgaa gccgcgggac tccgagaccc ttgtcccggg agaggcccag gcgcctttac      1140
     ccggtttcat tttcagttta ggccaaaaat ccccccgggt tggtcggggc ggggcggggc      1200
     tcgggggact gggctgaccg cggggtcggg gccaggttct cacaccatcc agataatgta      1260
     tggctgcgac gtggggccgg acgggcgctt cctccgcggg taccggcagg acgcctacga      1320
     cggcaaggat tacatcgccc tgaacgagga cctgcgctct tggaccgcgg cggacatggc      1380
     agctcagatc accaagcgca agtgggaggc ggtccatgcg gcggagcagc ggagagtcta      1440
     cctggagggc cggtgcgtgg acgggctccg cagatacctg gagaacggga aggagacgct      1500
     gcagcgcacg ggtaccaggg gccacggggc gcctccctga tcgcctatag atctcccggg      1560
     ctggcctccc acaaggaggg gagacaattg ggaccaacac tagaatatca ccctccctct      1620
     ggtcctgagg gagaggaatc ctcctgggtt tccagatcct gtaccagaga gtgactctga      1680
     ggttccgccc tgctctctga cacaattaag ggataaaatc tctgaaggag tgacgggaag      1740
     acgatccctc gaatactgat gagtggttcc ctttgacacc ggcagcagcc ttgggcccgt      1800
     gacttttcct ctcaggcctt gttctctgct tcacactcaa tgtgtgtggg ggtctgagtc      1860
     cagcacttct gagtctctca gcctccactc aggtcaggac cagaagtcgc tgttcccttc      1920
     tcagggaata gaagattatc ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct      1980
     ctcttcccca tcccgggtgt cctgtccatt ctcaagatgg ccacatgcgt gctggtggag      2040
     tgtcccatga cagatgcaaa atgcctgaat tttctgactc ttcccgtcag acccccccaa      2100
     gacacatatg acccaccacc ccatctctga ccatgaggcc accctgaggt gctgggccct      2160
     gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg accagaccca      2220
     ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga agtgggcggc      2280
     tgtggtggtg ccttctggag aggagcagag atacacctgc catgtgcagc atgagggtct      2340
     gcccaagccc ctcaccctga gatggggtaa ggagggagat gggggtgtca tgtctcttag      2400
     ggaaagcagg agcctctctg gagaccttta gcagggtcag ggcccctcac cttcccctct      2460
     tttcccagag ctgtcttccc agcccaccat ccccatcgtg ggcatcattg ctggcctggt      2520
     tctccttgga gctgtgatca ctggagctgt ggtcgctgcc gtgatgtgga ggaggaagag      2580
     ctcaggtgga gaaggggtga agggtggggt ctgagatttc ttgtctcact gagggttcca      2640
     agccccagct agaaatgtgc cctgtctcat tactgggaag caccttccac aatcatgggc      2700
     cgacccagcc tgggccctgt gtgccagcac ttactctttt gtaaagcacc tgttaaaatg      2760
     aaggacagat ttatcacctt gattacggcg gtgatgggac ctgatcccag cagtcacaag      2820
     tcacagggga aggtccctga ggacagacct caggagggct attggtccag gacccacacc      2880
     tgctttcttc atgtttcctg atcccgccct gggtctgcag tcacacattt ctggaaactt      2940
     ctctggggtc caagactagg aggttcctct aggaccttaa ggccctggct cctttctggt      3000
     atctcacagg acattttctt cccacagata gaaaaggagg gagttacact caggctgcaa      3060
     gtaagtatga aggaggctga tgcctgaggt ccttgggata ttgtgtttgg gagcccatgg      3120
     gggagctcac ccaccccaca attcctcctc tagccacatc ttctgtggga tctgaccagg      3180
     ttctgttttt gttctacccc aggcagtgac agtgcccagg gctctgatgt gtctctcaca      3240
     gcttgtaaag gtgagagctt ggagggcctg atgtgtgttg ggtgttgggt ggaacagtgg      3300
     acacagctgt gctatggggt ttctttgcgt tggatgtatt gagcatgcga tgggctgttt      3360
     aaggtgtgac ccctcactgt gatggatatg aatttgttca tgaatatttt tttctatagt      3420
     gtgagacagc tgccttgtgt gggactgaga ggcaagagtt gttcctgccc ttccctttgt      3480
     gacttgaaga accctgactt tgtttctgca aaggcacctg catgtgtctg tgttcgtgta      3540
     ggcataatgt gaggaggtgg ggagagcacc ccacccccat gtccaccatg accctcttcc      3600
     cacgctgacc tgtgctccct ctccaatcat ctttcctgtt ccagagaggt ggggctgagg      3660
     tgtctccatc tctgtctcaa cttcatggtg cactgagctg taacttcttc cttccctatt      3720
     aaaattagaa cctgagtata aatttacttt ctcaaattct tgccatgaga ggttgatgag      3780
     ttaattaaag gagaagattc ctaaaatttg agagacaaaa ttaatggaac gcatgagaac      3840
//


spacer
spacer