spacer

EBI Dbfetch

ID   X17273; SV 1; linear; mRNA; STD; HUM; 1301 BP.
XX
AC   X17273;
XX
DT   28-MAY-1990 (Rel. 24, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 15)
XX
DE   Human HLA G (HLA 6.0) mRNA for non classical class I transplantation
DE   antigen
XX
KW   HLA 6.0 antigen; HLA G antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1301
RA   Swaroop A.;
RT   ;
RL   Submitted (12-DEC-1989) to the INSDC.
RL   Swaroop A., Yale University School of Medicine, Department of Human
RL   Genetic, Box 3333 333 Cedar Street, New Haven CT 06510, U S A.
XX
RN   [2]
RP   1-1301
RX   DOI; 10.1093/nar/18.8.2189.
RX   PUBMED; 2336406.
RA   Shukla H., Swaroop A., Srivastava R., Weissman S.M.;
RT   "The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted
RT   pattern of expression";
RL   Nucleic Acids Res. 18(8):2189-2189(1990).
XX
DR   MD5; 6cfb99038c8ddd212e2890591e2f20b1.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
CC   See  for corresponding genomic sequence.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1301
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="mRNA"
FT                   /dev_stage="Fetus (11 weeks)"
FT                   /clone_lib="LASFE2"
FT                   /clone="ASR 53"
FT                   /tissue_type="eye"
FT                   /db_xref="taxon:9606"
FT   CDS             6..1022
FT                   /note="precursor (AA -24 to 314)"
FT                   /db_xref="GOA:P17693"
FT                   /db_xref="H-InvDB:HIT000321610.15"
FT                   /db_xref="HGNC:HGNC:4964"
FT                   /db_xref="IMGT/HLA:G*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1YDP"
FT                   /db_xref="PDB:2D31"
FT                   /db_xref="PDB:2DYP"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="PDB:3KYN"
FT                   /db_xref="PDB:3KYO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17693"
FT                   /protein_id="CAA35174.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   sig_peptide     6..77
FT                   /note="signal peptide (AA -24 to -1)"
FT   misc_feature    15..17
FT                   /note="alternative translational start"
FT   mat_peptide     78..1019
FT                   /note="mature HLA G antigen (AA 1-314)"
FT   misc_feature    1280..1285
FT                   /note="pot. polyadenylation signal"
FT   polyA_site      1301..1301
FT                   /note="polyadenylation site"
XX
SQ   Sequence 1301 BP; 265 A; 382 C; 403 G; 251 T; 0 other;
     caaggatggt ggtcatggcg ccccgaaccc tcttcctgct gctctcgggg gccctgaccc        60
     tgaccgagac ctgggcgggc tcccactcca tgaggtattt cagcgccgcc gtgtcccggc       120
     ccggccgcgg ggagccccgc ttcatcgcca tgggctacgt ggacgacacg cagttcgtgc       180
     ggttcgacag cgactcggcg tgtccgagga tggagccgcg ggcgccgtgg gtggagcagg       240
     aggggccgga gtattgggaa gaggagacac ggaacaccaa ggcccacgca cagactgaca       300
     gaatgaacct gcagaccctg cgcggctact acaaccagag cgaggccagt tctcacaccc       360
     tccagtggat gattggctgc gacctggggt ccgacggacg cctcctccgc gggtatgaac       420
     agtatgccta cgatggcaag gattacctcg ccctgaacga ggacctgcgc tcctggaccg       480
     cagcggacac tgcggctcag atctccaagc gcaagtgtga ggcggccaat gtggctgaac       540
     aaaggagagc ctacctggag ggcacgtgcg tggagtggct ccacagatac ctggagaacg       600
     ggaaggagat gctgcagcgc gcggaccccc ccaagacaca cgtgacccac caccctgtct       660
     ttgactatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcatac       720
     tgacctggca gcgggatggg gaggaccaga cccaggacgt ggagctcgtg gagaccaggc       780
     ctgcagggga tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaggagc       840
     agagatacac gtgccatgtg cagcatgagg ggctgccgga gcccctcatg ctgagatgga       900
     agcagtcttc cctgcccacc atccccatca tgggtatcgt tgctggcctg gttgtccttg       960
     cagctgtagt cactggagct gcggtcgctg ctgtgctgtg gagaaagaag agctcagatt      1020
     gaaaaggagg gagctactct caggctgcaa tgtgaaacag ctgccctgtg tgggactgag      1080
     tggcaagtcc ctttgtgact tcaagaaccc tgacttctct ttgtgcagag accagcccac      1140
     ccctgtgccc accatgaccc tcttcctcat gctgaactgc attccttccc caatcacctt      1200
     tcctgttcca gaaaaggggc tgggatgtct ccgtctctgt ctcaaatttg tggtccactg      1260
     agctataact tacttctgta ttaaaattag aatctgagta t                          1301
//


spacer
spacer