Dbfetch

ID   X17093; SV 1; linear; genomic DNA; STD; HUM; 4316 BP.
XX
AC   X17093;
XX
DT   29-JAN-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human HLA-F gene for human leukocyte antigen F
XX
KW   HLA-F gene; leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4316
RA   Geraghty D.E.;
RT   ;
RL   Submitted (07-NOV-1989) to the INSDC.
RL   Geraghty D. E., Fred Hutchinson Cancer Research Center, 1124 Columbia St.,
RL   M718, Seattle WA 98104, USA.
XX
RN   [2]
RP   1-4316
RX   DOI; 10.1084/jem.171.1.1.
RX   PUBMED; 1688605.
RA   Geraghty D.E., Wei X., Orr H., Koller B.H.;
RT   "Human leukocyte antigen F (HLA-F). An expressed HLA gene composed of a
RT   class I coding sequence linked to a novel transcribed repetitive element";
RL   J. Exp. Med. 171(1):1-18(1990).
XX
DR   MD5; b3dc320b2e35ae889e33a5dd437f5d1c.
DR   Ensembl-Gn; ENSG00000137403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206509; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229698; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237508; homo_sapiens.
DR   Ensembl-Tr; ENST00000259951; homo_sapiens.
DR   Ensembl-Tr; ENST00000334668; homo_sapiens.
DR   Ensembl-Tr; ENST00000359076; homo_sapiens.
DR   Ensembl-Tr; ENST00000376848; homo_sapiens.
DR   Ensembl-Tr; ENST00000376861; homo_sapiens.
DR   Ensembl-Tr; ENST00000383515; homo_sapiens.
DR   Ensembl-Tr; ENST00000420067; homo_sapiens.
DR   Ensembl-Tr; ENST00000434407; homo_sapiens.
DR   Ensembl-Tr; ENST00000440590; homo_sapiens.
DR   IMGT/LIGM; X17093.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4316
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda Charon 21a"
FT                   /clone="HLA-5.4"
FT                   /cell_line="LCL 721.144"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   misc_feature    79..293
FT                   /note="long polypurine stretch"
FT   misc_feature    538..567
FT                   /note="short polypurine stretch"
FT   misc_feature    640..652
FT                   /note="palindromic sequence"
FT   misc_feature    661..675
FT                   /note="interferon consensus sequence"
FT   misc_feature    737..747
FT                   /note="HLA promoter"
FT   regulatory      763..767
FT                   /note="CAAT box"
FT                   /regulatory_class="promoter"
FT   regulatory      791..796
FT                   /note="TATA box"
FT                   /regulatory_class="promoter"
FT   CDS             join(850..913,1044..1313,1558..1833,2416..2691,2832..2948,
FT                   3396..3428,3564..3611,3788..3792)
FT                   /product="leukocyte antigen F"
FT                   /db_xref="GOA:P30511"
FT                   /db_xref="HGNC:HGNC:4963"
FT                   /db_xref="IMGT/HLA:F*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30511"
FT                   /protein_id="CAA34947.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAVTDSAQGSGVSLTANKV"
FT   exon            <850..913
FT                   /number=1
FT   intron          914..1043
FT                   /number=1
FT   exon            1044..1313
FT                   /number=2
FT   intron          1314..1557
FT                   /number=2
FT   exon            1558..1833
FT                   /number=3
FT   intron          1834..2415
FT                   /number=3
FT   exon            2416..2691
FT                   /number=4
FT   intron          2692..2831
FT                   /number=4
FT   exon            2832..2948
FT                   /number=5
FT   intron          2949..3395
FT                   /number=5
FT   exon            3396..3428
FT                   /number=6
FT   intron          3429..3563
FT                   /number=6
FT   exon            3564..3611
FT                   /number=7
FT   intron          3612..3787
FT                   /number=7
FT   exon            3788..>3792
FT                   /number=8
FT   regulatory      3879..3884
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      3886..3891
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4316 BP; 1000 A; 1090 C; 1292 G; 934 T; 0 other;
     ctgcagctaa taaaaaaaaa aaaagaaaga aagaaactgg tctctgtcct atttcatatg        60
     ctcaggtaca acttttccag agaagaagag gaggggggcg gggaggagca ggaggaggag       120
     gaaagaagga ggagaaggag aaggagaaga agaggaagag gaagaggaag aagaagaaga       180
     agaagaagag gaagaggaag aggaagaaga agaagaagaa gaagaagaag aagaagaaga       240
     agaagaagaa gaagaagaag aagaagaaga ggaagaagag gaagaagaag aaactgtctc       300
     tagaccttca ttctcaggac aagttcattg tctggcacca agctccttgg ggtgaatttt       360
     cttccaaaag agtccgggga gtccaggtat ggaatgggag gcagaaagtt caatcaaggg       420
     actgggattt cggaatgaat aatgaaggga gatggactgg gtccatgccg aaggtttctc       480
     cctggtttct cagcccccgg gcgaagactc agggagacat tgagacacac cctgcacagg       540
     agggggaggg ggagggggag ggcaaagtcc cagggcccca ggagtggctc tcaagggctc       600
     aggccccgag gcggtgtctg gggttggaag gctcagtatt gagaattccc catctcccca       660
     gagtttctct ttctctccca acccgtgtca ggtccttcat cctggatact cataacgcgg       720
     ccccatttct cactcccatt gggcgtcgcg tttctagaga agccaatcag tgtcgccgca       780
     gttcccaggt tctaaagtcc cacgcacccc gcgggactca tatttttccc agacgcggag       840
     gttggggtca tggcgccccg aagcctcctc ctgctgctct caggggccct ggccctgacc       900
     gatacttggg cgggtgagtg cggggtccag agagaaacgg cctctgtggg gaggagtgag       960
     gggcccgccc ggtgggggcg caggactcag ggagccgcgc ccggaggagg gtctggcggg      1020
     tctcaccccc tcctcgcccc caggctccca ctccttgagg tatttcagca ccgctgtgtc      1080
     gcggcccggc cgcggggagc cccgctacat cgccgtggag tacgtagacg acacgcaatt      1140
     cctgcggttc gacagcgacg ccgcgattcc gaggatggag ccgcgggagc cgtgggtgga      1200
     gcaagagggg ccgcagtatt gggagtggac cacagggtac gccaaggcca acgcacagac      1260
     tgaccgagtg gccctgagga acctgctccg ccgctacaac cagagcgagg ctggtgagtg      1320
     aacccggccg ggggcgcagg tcacgaccac cccccatccg ccacggaccg cccgggtccc      1380
     cccgagtctc cggatccgaa atctaccccg aggcagcgga cccgcccaga ccctccaccc      1440
     gggagagtcc caggcgcctt taccgaggtt cattttcagt ttaggccaaa atccccgcgg      1500
     gttgggcggg gagggggcgg ggctagctgg gcggggctga ctgcggggac cggctagggt      1560
     ctcacaccct ccagggaatg aatggctgcg acatggggcc cgacggacgc ctcctccgcg      1620
     ggtatcacca gcacgcgtac gacggcaagg attacatctc cctgaacgag gacctgcgct      1680
     cctggaccgc ggcggacacc gtggctcaga tcacccagcg cttctatgag gcagaggaat      1740
     atgcagagga gttcaggacc tacctggagg gcgagtgcct ggagttgctc cgcagatact      1800
     tggagaatgg gaaggagacg ctacagcgcg caggtaccag gggccatggg cgccttccct      1860
     atctcctgta gatctcttgg gatggcctcg cacaaggttg ggaggaaagt gggcccaatg      1920
     ctaggatatc gccctccctc tagtcctgag taggaagaat cttcctggct ttcgagatcc      1980
     ggtaccagag agtgactgtg agagtccgcc ctgctctctg ggacaattaa gggatgaaat      2040
     ctctgaggga atggagggaa gacagtccct ggaataccga tccgcggtcc cctttgagcc      2100
     ctccaacagc cttgggcccc gtgacttttc tctcaagttt tgttctctgc ctcacactca      2160
     atgtgtttgg ggctctgatt ccagtccctc ggcctccact taggtcaggg ccagaagtcc      2220
     ctgctcccca ctcagagact cgaactttcc aaggaatagg agattttccc aggtgtctgt      2280
     gtccaggctg gtgtctgggt tctgtgctcc cttccccacc ccaggtgtcc tgtccattct      2340
     caggttggtc acatgggtgc tgctggggtt tcccatgagg agtgcaaagt gcctgaattt      2400
     tctgactctt ctcagatcct ccaaaggcac acgttgccca ccaccccatc tctgaccatg      2460
     aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcacg ctgacctggc      2520
     agcgggatgg ggaggaacag acccaggaca cagagcttgt ggagaccagg cctgcagggg      2580
     atggaacctt ccagaagtgg gccgctgtgg tggtgccttc tggagaggaa cagagataca      2640
     catgccatgt gcagcacgag gggctgcccc agcccctcat cctgagatgg ggtaaggagg      2700
     gagatgggta aagaggggaa cgaggggtca tgtcttttct cagggaaagc aggagccctt      2760
     ctggagctct tcagcagggt cagggctgag gcctggagat cagggcccct caccttccct      2820
     tcctttccca gagcagtctc cccagcccac catccccatc gtgggcatcg ttgctggcct      2880
     tgttgtcctt ggagctgtgg tcactggagc tgtggtcgct gctgtgatgt ggaggaagaa      2940
     gagctcaggt aggaaggggt gaggagtgga gtctgagttt tcttgtccca ctgggggttg      3000
     caagccccaa gtagaagtgt gccctgcctc attactggga agcaccatcc acactcatgg      3060
     gtctacccag cctgggccct gtgtgccagc acctactcat ttgtaaagct cctgtgaaaa      3120
     tgaaggacag attcttcact tcgatgatta tggtggtgat gggacctgat cccagcagtc      3180
     acaaatcaca ggggaaggtc cctgctgatg acagacctca ggagggcagt tggtccagga      3240
     cccacatctg ctttcttcat atttcttgat cctgccctgg atctacagtt acacttttct      3300
     ggaaacttct ctgggatcaa agactagggg tttgctctag gaccttatgg ccctgcctcc      3360
     tttctggcct ctcacaggac attttcttcc catagataga aacagaggga gctactctca      3420
     ggctgcaggt aagatgaagg aggctgatcc ctgagattgt tgggatattg tggtcaggag      3480
     cctatgaggg agctcaccca ccccacagtt cctctagcca catctgtggg ctctgaccag      3540
     gtcctgtttt tgttctaccc caatcactga cagtgcccag ggctctgggg tgtctctcac      3600
     agctaataaa ggtgacactc cagggcaggg gccctgatgt gagtggggtg ttggggggga      3660
     acagagggga ctcagctgtg ctattgggtt tctttgactt ggatgtcttg agcatgaaat      3720
     gggctattta gagtgttacc tctcactgtg actgatacga atttgttcat gaatattttc      3780
     tctatagtgt gagacagctt ccttgtgtgg gactgagaag caagatatca atgtagcaga      3840
     attgcacttg tgcctcacga acatacataa attttaaaaa taaagaataa aaatatatct      3900
     ttttatagat acaggtagat atgtttttat agcatgcacg taaatgtgtg tgtgtgtgtg      3960
     tgtgtgtgaa gagaaagagt gaatagagag attaagattc ttttaatggt gaaaagatat      4020
     acatatattt ggaattagcc agcttgactc agtttaggtg atcccaattt tggtggcaac      4080
     aaccaaagca tcgtagtcag gagccagtcg aacatatgcc ttcctctctc catcagactg      4140
     aatcagagtg ttgactttgg ccacatcaat gtcacaaact tcttcacagc ctgtttgatc      4200
     tggtgcttgt tggctttaac atccacagtg aacacaagta ggctgttgtt ttctatcttc      4260
     ttcacagcct actcagtggt cagcggaaac ttgatgataa catggtggtc aagctt          4316
//