spacer

EBI Dbfetch

ID   X16649; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   X16649;
XX
DT   29-APR-1990 (Rel. 24, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human HLA-DRB1 gene for HLA-DRw13b
XX
KW   class II transplantation antigen; HLA-DRB1 gene;
KW   major histocompatibility complex; transmembrane glycoprotein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (28-SEP-1989) to the INSDC.
RL   Arnaiz-Villena A., Immunology, Hospital Doce De Octubre, CTRA. Andalucia
RL   KM. 5.4, 28041 - Madrid, Spain.
XX
RN   [2]
RP   1-270
RX   DOI; 10.1016/0161-5890(90)90145-P.
RX   PUBMED; 2342492.
RA   Corell A., Martin-Villa J.M., Varela P., Vicario J.L., Martinez-Laso J.,
RA   Arnaiz-Villena A.;
RT   "Exon 2 DNA sequence of the HLA-DRw13b allele obtained from genomes of five
RT   different individuals";
RL   Mol. Immunol. 27(3):313-316(1990).
XX
DR   MD5; f5453c1c6e8d4426c73294d2ccfbe03e.
XX
CC   See  for overlapping sequence.
CC   
CC   Data kindly reviewed (16-JUL-1990) by Arnaiz-Villena A.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /strain="patients MRS, EGS, OSC, MGA, JRS"
FT                   /mol_type="genomic DNA"
FT                   /clone="MRS-21, EGS-3, OSC-3, MGA-1, JRS-3"
FT                   /cell_type="mature white blood cells"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /note="HLA-DRw13b beta-chain (90 AA)"
FT                   /db_xref="GOA:Q29821"
FT                   /db_xref="IMGT/HLA:DRB1*13:03:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29821"
FT                   /protein_id="CAA34642.1"
FT                   /translation="RILRVPTARFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDS
FT                   DVGEYRAVTELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGVGE"
FT   mRNA            1..270
FT                   /note="exon"
XX
SQ   Sequence 270 BP; 58 A; 68 C; 93 G; 51 T; 0 other;
     cggatccttc gtgtccccac agcacgtttc ttggagtact ctacgtctga gtgtcatttc        60
     ttcaatggga cggagcgggt gcggttcctg gacagatact tctataacca agaggagtac       120
     gtgcgcttcg acagcgacgt gggggagtac cgggcggtga cggagctggg gcggcctagc       180
     gccgagtact ggaacagcca gaaggacatc ctggaagaca agcgggccgc ggtggacacc       240
     tactgcagac acaactacgg ggttggggag                                        270
//


spacer
spacer