Dbfetch

ID   X14356; SV 1; linear; mRNA; STD; HUM; 1321 BP.
XX
AC   X14356; M21091;
XX
DT   17-FEB-1989 (Rel. 18, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Human mRNA for high affinity Fc receptor (FcRI)
XX
KW   Fc receptor; FcRI receptor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1321
RA   Seed B.;
RT   ;
RL   Submitted (25-OCT-1988) to the INSDC.
XX
RN   [2]
RP   1-1321
RX   DOI; 10.1093/nar/16.24.11824.
RX   PUBMED; 2974947.
RA   Allen J.M., Seed B.;
RT   "Nucleotide sequence of three cDNAs for the human high affinity Fc receptor
RT   (FcRI)";
RL   Nucleic Acids Res. 16(24):11824-11824(1988).
XX
DR   MD5; bdc5aa143f4b3dff0dbf8727db58444d.
DR   Ensembl-Gn; ENSG00000150337; homo_sapiens.
DR   Ensembl-Tr; ENST00000369168; homo_sapiens.
DR   EuropePMC; PMC136976; 12163579.
DR   EuropePMC; PMC236725; 7511171.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1321
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="fcr135"
FT                   /db_xref="taxon:9606"
FT   CDS             37..1161
FT                   /note="FcRI (AA 1-374)"
FT                   /db_xref="GOA:P12314"
FT                   /db_xref="H-InvDB:HIT000321422.14"
FT                   /db_xref="HGNC:HGNC:3613"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:3RJD"
FT                   /db_xref="PDB:4W4O"
FT                   /db_xref="PDB:4X4M"
FT                   /db_xref="PDB:4ZNE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12314"
FT                   /protein_id="CAA32537.1"
FT                   /translation="MWFLTTLLLWVPVDGQVDTTKAVISLQPPWVSVFQEETVTLHCEV
FT                   LHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGW
FT                   LLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHN
FT                   GTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPG
FT                   LQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVL
FT                   GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVTSS
FT                   LQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT"
XX
SQ   Sequence 1321 BP; 368 A; 324 C; 324 G; 305 T; 0 other;
     gacagatttc actgctccca ccagcttgga gacaacatgt ggttcttgac aactctgctc        60
     ctttgggttc cagttgatgg gcaagtggac accacaaagg cagtgatctc tttgcagcct       120
     ccatgggtca gcgtgttcca agaggaaacc gtaaccttgc actgtgaggt gctccatctg       180
     cctgggagca gctctacaca gtggtttctc aatggcacag ccactcagac ctcgaccccc       240
     agctacagaa tcacctctgc cagtgtcaat gacagtggtg aatacaggtg ccagagaggt       300
     ctctcagggc gaagtgaccc catacagctg gaaatccaca gaggctggct actactgcag       360
     gtctccagca gagtcttcac ggaaggagaa cctctggcct tgaggtgtca tgcgtggaag       420
     gataagctgg tgtacaatgt gctttactat cgaaatggca aagcctttaa gtttttccac       480
     tggaattcta acctcaccat tctgaaaacc aacataagtc acaatggcac ctaccattgc       540
     tcaggcatgg gaaagcatcg ctacacatca gcaggaatat ctgtcactgt gaaagagcta       600
     tttccagctc cagtgctgaa tgcatctgtg acatccccac tcctggaggg gaatctggtc       660
     accctgagct gtgaaacaaa gttgctcttg cagaggcctg gtttgcagct ttacttctcc       720
     ttctacatgg gcagcaagac cctgcgaggc aggaacacat cctctgaata ccaaatacta       780
     actgctagaa gagaagactc tgggttatac tggtgcgagg ctgccacaga ggatggaaat       840
     gtccttaagc gcagccctga gttggagctt caagtgcttg gcctccagtt accaactcct       900
     gtctggtttc atgtcctttt ctatctggca gtgggaataa tgtttttagt gaacactgtt       960
     ctctgggtga caatacgtaa agaactgaaa agaaagaaaa agtgggattt agaaatctct      1020
     ttggattctg gtcatgagaa gaaggtaact tccagccttc aagaagacag acatttagaa      1080
     gaagagctga aatgtcagga acaaaaagaa gaacagctgc aggaaggggt gcaccggaag      1140
     gagccccagg gggccacgta gcagcggctc agtgggtggc catcgatctg gaccgtcccc      1200
     tgcccacttg ctccccgtga gcactgcgta caaacatcca aaagttcaac aacaccagaa      1260
     ctgtgtgtct catggtatgt aactcttaaa gcaaataaat gaactgactt caaaaaaaaa      1320
     a                                                                      1321
//