Dbfetch

ID   X13450; SV 1; linear; mRNA; STD; MUS; 985 BP.
XX
AC   X13450;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 4)
XX
DE   Murine B lymphocyte lineage restricted mb-1 mRNA
XX
KW   cell surface glycoprotein; cell-surface marker; glycoprotein; mb-1 gene;
KW   membrane protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-985
RX   PUBMED; 2463161.
RA   Sakaguchi N., Kashiwamura S., Kimoto M., Thalmann P., Melchers F.;
RT   "B lymphocyte lineage-restricted expression of mb-1, a gene with CD3-like
RT   structural properties";
RL   EMBO J. 7(11):3457-3464(1988).
XX
DR   MD5; 1c49eaf10c12059f857d202198446f3a.
DR   Ensembl-Gn; ENSMUSG00000003379; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031755; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031834; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032295; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030892; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031517; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031671; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031624; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031750; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031661; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032327; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030996; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003469; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082227; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082239; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082256; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081855; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082727; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082379; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0081961; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081837; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0081987; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081859; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083005; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081803; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080910; mus_musculus_wsbeij.
XX
CC   Data kindly reviewed (23-Jun-1989) by Sakaguchi N.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..985
FT                   /organism="Mus musculus"
FT                   /strain="(C57BL/6JxDBA/2J)F1"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10"
FT                   /clone="m-mb-1-W-8"
FT                   /cell_line="WEHI231"
FT                   /cell_type="B-cell lymphoma"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..985
FT                   /note="m-mb-1 mRNA"
FT   CDS             10..672
FT                   /note="m-mb-1 protein (AA 1 - 220)"
FT                   /db_xref="GOA:P11911"
FT                   /db_xref="InterPro:IPR003110"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:101774"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11911"
FT                   /protein_id="CAA31801.1"
FT                   /translation="MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEE
FT                   ARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNTGACTGCQVI
FT                   ENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRW
FT                   QNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP"
FT   misc_feature    181..183
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    211..213
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    967..972
FT                   /note="pot. polyA signal"
FT   polyA_site      985..985
FT                   /note="polyA site"
XX
SQ   Sequence 985 BP; 216 A; 308 C; 240 G; 221 T; 0 other;
     tgggagacga tgccaggggg tctagaagcc ctcagagccc tgcctctcct cctcttcttg        60
     tcatacgcct gtttgggtcc cggatgccag gccctgcggg tagaaggggg tccaccatcc       120
     ctgacggtga acttgggcga ggaggcccgc ctcacctgtg aaaacaatgg caggaaccct       180
     aatatcacat ggtggttcag ccttcagtct aacatcacat ggcccccagt gccactgggt       240
     cctggccagg gtaccacagg ccagctgttc ttccccgaag taaacaagaa cacaggggct       300
     tgtactgggt gccaagtgat agaaaacaac atattaaaac gctcctgtgg tacttacctc       360
     cgcgtgcgca atccagtccc taggcccttc ctggacatgg gggaaggtac caagaaccgc       420
     atcatcacag cagaagggat catcttgctg ttctgtgcag tggtgccagg gacgctgctg       480
     ctattcagga aacggtggca aaatgagaag tttggggtgg acatgccaga tgactatgaa       540
     gatgaaaatc tctatgaggg cctgaacctt gatgactgtt ctatgtatga ggacatctcc       600
     aggggactcc agggcaccta ccaggatgtg ggcaacctcc acattggaga tgcccagctg       660
     gaaaagccat gactgacatg tcccaccctt ccctgcctgc catatgtctg actccagcat       720
     ccctgcctcc ccactcttcc cctggagtcc ccccttccca gtgcttgctc cagccactcg       780
     agtgcgctac ccttgcctcc aggctgcccc accctattct cccacctaat cttgtccttc       840
     cccaagtcca gctccctctc tagtgggtaa tgagccctta atcgctgcct ctaggggagc       900
     tgattacagc atcctcgtta gtgtcacccc ccctcctccc agatctgtca tggccactta       960
     agtgataata aatccttccc aaagc                                             985
//