spacer

EBI Dbfetch

ID   X13112; SV 1; linear; mRNA; STD; HUM; 895 BP.
XX
AC   X13112; X12781;
XX
DT   01-DEC-1988 (Rel. 18, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human partial mRNA for MHC class I antigen HLA-A11K
XX
KW   antigen; cell surface glycoprotein; class I antigen;
KW   major histocompatibility complex; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-895
RA   Mayer W.E.;
RT   ;
RL   Submitted (03-OCT-1988) to the INSDC.
RL   W.E. Mayer, Stanford University, Dept. of Biological Sciences, Stanford, CA
RL   94305-5020, USA.
XX
RN   [2]
RP   1-895
RX   PUBMED; 2460344.
RA   Mayer W.E., Jonker M., Klein D., Ivanyi P., van Seventer G., Klein J.;
RT   "Nucleotide sequences of chimpanzee MHC class I alleles: evidence for
RT   trans-species mode of evolution";
RL   EMBO J. 7(9):2765-2774(1988).
XX
DR   MD5; 522435109bdb539e944a361ff70f0b33.
XX
CC   *sourc: clone=pV5-1A.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p."
FT                   /mol_type="mRNA"
FT                   /cell_line="K.LIE-EBV"
FT                   /tissue_type="peripheral blood lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>895
FT                   /note="HLA-A11K protein precursor (AA -24 to 274) (895 is
FT                   1st base in codon)"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4UQ2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="CAA31504.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGKPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   misc_feature    1..72
FT                   /note="leader peptide (AA -24 to -1)"
FT   misc_feature    73..342
FT                   /note="alpha-1 domain"
FT   misc_feature    343..618
FT                   /note="alpha-2 domain"
FT   misc_feature    619..894
FT                   /note="alpha-3 domain"
XX
SQ   Sequence 895 BP; 178 A; 282 C; 307 G; 128 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcgggaagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg cccatgcggc ggagcagcag       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggg            895
//


spacer
spacer