spacer

EBI Dbfetch

ID   X13111; SV 1; linear; mRNA; STD; HUM; 1411 BP.
XX
AC   X13111; X12781;
XX
DT   29-NOV-1988 (Rel. 18, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human mRNA for HLA-A11E, a MHC class I molecule (major histocompatibility
DE   complex)
XX
KW   HLA-A11E protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1411
RA   Mayer W.E.;
RT   ;
RL   Submitted (03-OCT-1988) to the INSDC.
RL   W.E. Mayer, Stanford University, Dept. of Biological Sciences, Stanford, CA
RL   94305-5020, USA.
XX
RN   [2]
RP   1-1411
RX   PUBMED; 2460344.
RA   Mayer W.E., Jonker M., Klein D., Ivanyi P., van Seventer G., Klein J.;
RT   "Nucleotide sequences of chimpanzee MHC class I alleles: evidence for
RT   trans-species mode of evolution";
RL   EMBO J. 7(9):2765-2774(1988).
XX
DR   MD5; e30505714ded5524ccf6a23b45247dc8.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
DR   EuropePMC; PMC30168; 11226269.
DR   H-InvDB; HIT000321348_03.4.
XX
CC   clone=pIII1-1A
CC   
CC   See also Cowan et al. Immunogenetics 25:241-250(1987) for the
CC   genomic sequences, HSHLA111-114.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1411
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="K.LIE-EBV"
FT                   /tissue_type="peripheral blood lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /note="HLA-A11E protein precursor (AA -24 to 341)"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="H-InvDB:HIT000321348_02.4"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4UQ2"
FT                   /protein_id="CAA31503.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     1..72
FT                   /note="leader peptide (AA -24 to -1)"
FT   mat_peptide     73..1095
FT                   /note="mature HLA-A11E protein (AA 1-341)"
FT   misc_feature    73..342
FT                   /note="alpha-1 domain"
FT   misc_feature    343..618
FT                   /note="alpha-2 domain"
FT   misc_feature    619..894
FT                   /note="alpha-3 domain"
FT   misc_feature    895..1011
FT                   /note="transmembrane domain"
FT   misc_feature    1012..1095
FT                   /note="cytoplasmic domain"
FT   misc_feature    1392..1397
FT                   /note="polyA signal"
FT   polyA_site      1411..1411
FT                   /note="polyA site"
XX
SQ   Sequence 1411 BP; 278 A; 420 C; 446 G; 267 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg cccatgcggc ggagcagcag       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtgaga cagctgcctt gtgtgggact gagaggcaag agttgttcct      1140
     gcccttccct ttgtgacttg aagaaccctg actttgtttc tgcaaaggca cctgcatgtg      1200
     tctgtgttcg tgtaggcata atgtgaggag gtggggagac caccccaccc cgatgtccac      1260
     catgaccctc ttcccacgct gacctgtgct ccctctccaa tcatctttcc tgttccagag      1320
     aggtggggct gaggtgtctc catctctgtc tcaacttcat ggtgcactga gctgtaactt      1380
     cttccttccc tattaaaatt agaacctgag t                                     1411
//


spacer
spacer