spacer

EBI Dbfetch

ID   X04057; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   X04057;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human HLA-DRB1*14.01 gene for class II antigen beta I chain (DRw6b)
XX
KW   antigen; class II antigen; histocompatibility antigen;
KW   major histocompatibility complex; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RX   DOI; 10.1038/322067a0.
RX   PUBMED; 3459965.
RA   Gorski J., Mach B.;
RT   "Polymorphism of human Ia antigens: gene conversion between two DR beta
RT   loci results in a new HLA-D/DR specificity";
RL   Nature 322(6074):67-70(1986).
XX
RN   [2]
RP   1-268
RA   Mach B.;
RT   ;
RL   Submitted (30-JUN-1988) to the INSDC.
XX
DR   MD5; 82d19eb7164130f273891b5ae2023db8.
XX
CC   Data kindly reviewed () by Mach B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRw6b"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>268
FT                   /codon_start=3
FT                   /note="DR antigen beta I first domain (1 is 3rd base in
FT                   codon) (268 is 2nd base in codon)"
FT                   /db_xref="GOA:Q6LBW7"
FT                   /db_xref="IMGT/HLA:DRB1*14:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LBW7"
FT                   /protein_id="CAE82080.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   old_sequence    57..57
FT                   /note="t was g in [1]"
FT                   /citation=[1]
FT   old_sequence    164..165
FT                   /note="gc was cg in [1]"
FT                   /citation=[1]
XX
SQ   Sequence 268 BP; 53 A; 65 C; 99 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcg                                          268
//


spacer
spacer