Dbfetch

ID   X04056; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   X04056;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human HLA-DRB1*13.01 gene for class II antigen beta I (DRw6a)
XX
KW   antigen; class II antigen; histocompatibility antigen;
KW   major histocompatibility complex; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RX   DOI; 10.1038/322067a0.
RX   PUBMED; 3459965.
RA   Gorski J., Mach B.;
RT   "Polymorphism of human Ia antigens: gene conversion between two DR beta
RT   loci results in a new HLA-D/DR specificity";
RL   Nature 322(6074):67-70(1986).
XX
DR   MD5; 1281623cc9f48c1952babcfd9ce0dbd9.
XX
CC   Data kindly reviewed () by Mach B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRw6a"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>258
FT                   /codon_start=2
FT                   /note="DR antigen beta I first domain (1 is 3rd base in
FT                   codon) (258 is 2nd base in codon)"
FT                   /db_xref="GOA:Q6LBW8"
FT                   /db_xref="IMGT/HLA:DRB1*13:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LBW8"
FT                   /protein_id="CAE82036.1"
FT                   /translation="EYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTEL
FT                   GRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 258 BP; 56 A; 62 C; 95 G; 45 T; 0 other;
     ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga        60
     cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg gggagttccg       120
     ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacatcct       180
     ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg ttgtggagag       240
     cttcacagtg cagcggcg                                                     258
//