Dbfetch

ID   X04055; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   X04055;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human gene for HLA-DR class II antigen beta III chain (DR3)
XX
KW   antigen; class II antigen; histocompatibility antigen;
KW   major histocompatibility complex; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RX   DOI; 10.1038/322067a0.
RX   PUBMED; 3459965.
RA   Gorski J., Mach B.;
RT   "Polymorphism of human Ia antigens: gene conversion between two DR beta
RT   loci results in a new HLA-D/DR specificity";
RL   Nature 322(6074):67-70(1986).
XX
DR   MD5; 15676ea4ad841899a060260dc3aea5e1.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   GOA; P79483.
DR   HGNC; HGNC:4951; HLA-DRB3.
DR   InterPro; IPR000353; MHC_II_b_N.
DR   InterPro; IPR003006; Ig/MHC_CS.
DR   InterPro; IPR003597; Ig_C1-set.
DR   InterPro; IPR007110; Ig-like_dom.
DR   InterPro; IPR013783; Ig-like_fold.
DR   PDB; 2Q6W; X-ray.
DR   PDB; 3C5J; X-ray.
DR   PDB; 4H1L; X-ray.
DR   UniProtKB/Swiss-Prot; P79483; DRB3_HUMAN.
XX
CC   Data kindly reviewed () by Mach B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR3"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>268
FT                   /codon_start=3
FT                   /note="DR beta III first domain (1 is 2nd base in codon)
FT                   (268 is 2nd base in codon)"
FT                   /db_xref="GOA:Q6LBW9"
FT                   /db_xref="IMGT/HLA:DRB3*01:01:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LBW9"
FT                   /protein_id="CAE82045.1"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 268 BP; 55 A; 65 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcg                                          268
//